CAZyme Information: EAQ88639.1

Basic Information

• Species: Chaetomium globosum
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Chaetomium; Chaetomium globosum
• CAZyme ID: EAQ88639.1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1059		115279.05	8.8333

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglobosumCBS148.51	11232	306901	184	11048

• Gene Location: location=CH408032:4707105-4711193(+)

Full Sequence      

MYWSRVASPKGIAPPVRAPHPFYLTRGAGTPEPHGVHICHKDATAWNQVSPGPESLSLTT
PHFPFHPFAVPTWWIMDCPQLAPEDFAKRKFDFIIVGGGTAGLAVAARLSEHPGFTVGVL
EAGSPAVGDNAVEFPGLAGRALGTPLDWGFETVPQKFLGGRRLPWARGKVLGGSSALNYM
TWNRAARQDYDDWRDLGNPGWGWDNLLPFFKKSESFHEPGDSVRKETPVSLHDGVVGRSG
PIQVSYPREFTASHKLWHRTMNSLGVETNHNHLAGSNIGCWTSVVSVDPEDITRSYATTA
YYKPVSSRPNLFLLTAAEVHEVLLTREGNAPNPWKAEGVRFSHGGVEFSAFAAREVILSA
GSIQSPQILELSGVGVANTHQNKATTSVFEVNPSLANPDDLRLDSVLAAACEEYAETRTG
PLTILPVSVSYVPAARYIRPDTLNMLLSSTAADTSDSPTAERSRLIRRRFQSRSNMLGHV
EFIFDLGNWGIDKPPLTSDGKKYGSLLQILQYPFSKGSVHIQPPVGDSNPRPRLAIDPQY
FGGREGHLDLEIALRAHRFAEKIWSAQPLASIIRAQVQPSLAETGTDEDLRSWLRRVATT
DWHPVGTCAMGGSAGSAGGVVDERLRVYGVKGLRVVDASVMPLQISAHLQATVNRGQCTK
AQRRNTVNASLEPVMRVLRTPNPCFNFLESPYFSKMRSNQIQRQVPSLPYYSPCRCPPAL
HWESTTRLRRKRFSPKAPRAIRSVSYPWNLRQAKADTMLPYHSLSLWLLAASSALVHASP
ASTRPDFSNIIERAVAATSSSGCGKTPFSSGTKSVTVNGKQRQFIVRVPSNYDQSKPYKL
IFAFHWVGGTMQDVSSGGTDKELWSYYGMQREAGETAILVAPQGINNGWANSGGEDIAFV
DAMSKYIEDALCVDQQQRFSVGFSYGGAMTYAIACARAKNFKGVAVIAGGQLSGCDGGND
PVAYLGIHGISDGTLNIAGGRGLRDRFVKNNGCATTNAPEPAQGSRTHIKTEYTGCKAGY
PVTWIAHDGGHWPGAVDNGPESGANSWVPGEIWSFFTNT

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	90	378	8.7e-102	0.5
AA3	382	653	3.8e-53	0.43133802816901406
CE1	818	951	1.7e-19	0.5903083700440529

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.00e-75	87	653	4	522	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.51e-70	87	653	2	520	choline dehydrogenase; Validated
366272	GMC_oxred_N	2.95e-29	159	380	15	207	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	2.76e-24	513	653	1	136	GMC oxidoreductase. This domain found associated with pfam00732.
226040	LpqC	6.27e-21	794	1059	18	307	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB84304.1|AA3_2	1.36e-195	84	653	8	593
QPG93538.1|AA3_2	5.76e-194	79	653	7	592
QLI72409.1|AA3_2	3.36e-193	82	653	10	594
QPC59540.1|AA3_2	2.30e-192	84	653	9	586
CEI62033.1|AA3_2	3.61e-191	84	653	9	586

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	7.02e-65	91	653	6	553	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	7.63e-58	90	656	5	574	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	3.05e-56	91	653	2	550	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	3.11e-56	91	653	3	551	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6XUT_A	9.20e-56	83	653	9	576	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	3.29e-83	85	653	8	597	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	3.29e-83	85	653	8	597	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A1C9D4|FAEC1_ASPCL	1.10e-78	794	1056	20	269	Probable feruloyl esterase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=faeC-1 PE=3 SV=1
sp|A4D9B6|FAEC_ASPFU	2.92e-78	796	1056	22	269	Probable feruloyl esterase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=faeC PE=3 SV=1
sp|B0XU32|FAEC_ASPFC	2.92e-78	796	1056	22	269	Probable feruloyl esterase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=faeC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000016	0.000028

TMHMM  Annotations     

There is no transmembrane helices in EAQ88639.1.