CAZyme Information: EAQ88471.1

Basic Information

• Species: Chaetomium globosum
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Chaetomium; Chaetomium globosum
• CAZyme ID: EAQ88471.1
• CAZy Family: GH2
• CAZyme Description: Carboxylic ester hydrolase [Source:UniProtKB/TrEMBL;Acc:Q2GZF6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311	CH408032|CGC26	33059.01	7.2889

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglobosumCBS148.51	11232	306901	184	11048

• Gene Location: location=CH408032:4213518-4214567(-)

Full Sequence      

MKFLGQLSAALALVGSAIAHPVFDELMEPTAPLKRAQAALTQVSNFGSNPSGAKMYIYVP
SRLATNPPVVVAIHYCTGTAQAYYSGSPYAQLADQKGFIVIYPESPYSGTCWDVSSRATL
SHNGGGNSNSIANMVNYTLNKYSGDASKVFVTGSSSGAMMTNVMAATYPEMFAAGIAYSG
VAAGCFLSQSGGAAAWNNSCANGQARGTPEVWAKMVTDMYPGYDGARPKMQIYHGSADTT
LNANNYNETIKQWCGVFGYDYTKPDSTQANTPQSRYTTYTWGDGQLVGVYAQGVGHSVPM
RGSDDMKYFGL

Enzyme Prediction     

EC	3.1.1.72:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	54	254	8.3e-24	0.801762114537445

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	2.87e-38	55	267	1	208	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
226040	LpqC	2.96e-25	37	299	31	277	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
402228	Esterase_phd	4.70e-20	57	252	5	194	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
224423	DAP2	4.87e-08	53	181	380	507	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
395257	Peptidase_S9	7.18e-06	90	182	7	99	Prolyl oligopeptidase family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO58247.1|CE1	1.49e-188	1	311	1	313
ADZ98864.1|CE1|3.1.1.72	1.00e-186	1	311	1	313
AEO67255.1|CE1	8.29e-179	27	311	1	284
CDP26566.1|CE1	4.18e-164	1	311	1	299
CAP61115.1|CE1	4.18e-164	1	311	1	299

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	1.72e-130	39	311	3	274	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CSZ8|AXE1_ASPCL	3.50e-137	30	311	27	306	Probable acetylxylan esterase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=axeA PE=3 SV=1
sp|A1DBP9|AXE1_NEOFI	7.96e-136	1	311	1	304	Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=axeA PE=3 SV=1
sp|Q4WBW4|AXE1_ASPFU	2.90e-134	39	311	33	304	Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=axeA PE=3 SV=1
sp|B8NBI2|AXE1_ASPFN	1.06e-133	39	311	34	305	Probable acetylxylan esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=axeA PE=3 SV=1
sp|Q96W96|AXE1_ASPFI	1.86e-133	18	311	9	302	Acetylxylan esterase A OS=Aspergillus ficuum OX=5058 GN=axeA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000402	0.999574	CS pos: 19-20. Pr: 0.9749

TMHMM  Annotations     

There is no transmembrane helices in EAQ88471.1.