CAZyme Information: EAQ88466.1

Basic Information

• Species: Chaetomium globosum
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Chaetomium; Chaetomium globosum
• CAZyme ID: EAQ88466.1
• CAZy Family: GH2
• CAZyme Description: GMC_OxRdtase_N domain-containing protein [Source:UniProtKB/TrEMBL;Acc:Q2GZG1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
643		69406.69	6.4576

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglobosumCBS148.51	11232	306901	184	11048

• Gene Location: location=CH408032:4200963-4202894(+)

Full Sequence      

MFFGRLLGLGAAYVALVRAVDLTGYEYVVVGSGPGGGPLAARLALAGHKTLLIEAGDDQG
ANINYTVPAYHARVSEDEHLSWNFFVRHYADDARQARDWKTSYDTPDGGVYTGLNPPPGS
KMKGVLYPRTGSMGGCSSHNAMVSVYPQRSDFEYMATLTGDSSWSPDNMRKYFQRLEKKQ
YLPGLPKGHGKDGWLTTELTPLTVPLKDPQLLATITGGAFALGDLTNQVINIGTLLAGDL
NADSERRDHNPHYYQIPIATNNGARTGAREFIVSVRDARNKDGSKKYPLDVRLNCHVTRV
VFDTTVSPPRATGVEFLDGAHLYRASPLSRSARAGTPGSATASREVIVSGGTYNSPQILQ
LSGVGPAAELARFGIPLVADLPGVGTNLQDHYETAVTAKVPKDWPALKGCTFQFNNTHDA
CLDRWQNPVLGDRGTYASAGLSVAMLHKSSASADGSFDTFVFGGPVNFAGYYPGYSYDAS
AEHNWWTWAVLKSHPRNTAGSVTLRSADPLDPPDVLYNYFDTGSGDAGADLQAMYEAIEL
ARRALRRQPVRTNEVLPGAEFNTQEEVEQYVKDGAWGHHASSTCPIGVDGDPMAVLDSQF
RVRGVQGLRVVDASVFPRIPGTFTAVSTYMVAEKAADDILSAV

Enzyme Prediction     

No EC number prediction in EAQ88466.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	24	640	2.3e-98	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	6.64e-70	39	640	20	532	choline dehydrogenase; Validated
225186	BetA	8.04e-63	39	642	22	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	5.82e-33	500	635	5	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.30e-21	289	622	235	559	Protein HOTHEAD
366272	GMC_oxred_N	3.70e-18	125	393	19	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDP26593.1|AA3	0.0	1	641	1	642
VBB76690.1|AA3	0.0	1	641	1	642
QMW33146.1|AA3	0.0	1	641	1	643
QRD84722.1|AA3	0.0	1	641	1	643
QMW45179.1|AA3	0.0	1	641	1	643

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YS1_AAA	1.61e-42	25	636	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6ZH7_A	1.61e-42	25	636	8	557	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS2_AAA	1.61e-42	25	636	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	1.61e-42	25	636	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	1.97e-42	25	636	24	573	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q66D54|BETA_YERPS	1.14e-45	25	639	3	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=betA PE=3 SV=1
sp|B2K8U4|BETA_YERPB	1.14e-45	25	639	3	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=betA PE=3 SV=1
sp|Q1C932|BETA_YERPA	2.13e-45	25	639	3	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) OX=360102 GN=betA PE=3 SV=1
sp|Q1CFR7|BETA_YERPN	2.13e-45	25	639	3	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=betA PE=3 SV=1
sp|Q8ZGW0|BETA_YERPE	2.13e-45	25	639	3	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis OX=632 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.005646	0.994334	CS pos: 19-20. Pr: 0.9448

TMHMM  Annotations     

There is no transmembrane helices in EAQ88466.1.