CAZyme Information: EAQ88138.1

Basic Information

• Species: Chaetomium globosum
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Chaetomium; Chaetomium globosum
• CAZyme ID: EAQ88138.1
• CAZy Family: GH18
• CAZyme Description: Dolichyl-phosphate beta-glucosyltransferase [Source:UniProtKB/TrEMBL;Acc:Q2H0D9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421		46420.28	7.5314

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglobosumCBS148.51	11232	306901	184	11048

• Gene Location: location=CH408032:3196975-3198437(+)

Full Sequence      

MAADGVVESLEQLVWLLWATASERPFYFLLAVVLPLFGLGIFCVYILLHLVAPKPRLSYP
SEKTYITTNPDGTASSPRPLACWYDRWHAEGKLSEEYSTIPAGFPVPDQGAIEPAEVEMS
VVVPAYNEEARITAALEEMVEYLDQQFGRPNNQFLQPERQERSAEKGGKKGKRATTPHRL
VFKPDTSTSTSPPGTARGPSEPPQPSGYEILIVDDGSRDRTVEVALSFARKHGLHDILRV
VKLAKNRGKGGAVTHGLRHVRGKYAVFADADGASRFSDLGKLIEGCEDRSAIRNFLMRSF
HFVLTILTPPATSRIRDTQCGFKLFSRAALPHIVPYMHAEGWIFDIEMLMLAESAPATPV
LASDGSVIGTSYGIKVAEVPVGWHEVDGSKMSLVQDSVRMAIGLAVLRASWMLGVYRRRL
T

Enzyme Prediction     

No EC number prediction in EAQ88138.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	205	288	7.9e-21	0.47058823529411764

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133031	DPG_synthase	2.31e-78	121	390	1	211	DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate.
240336	PTZ00260	2.80e-66	115	417	68	322	dolichyl-phosphate beta-glucosyltransferase; Provisional
133022	DPM_DPG-synthase_like	1.90e-48	121	352	1	185	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
133030	DPM1_like_bac	4.64e-20	208	336	30	165	Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.
395426	Glycos_transf_2	1.27e-19	208	284	28	101	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO55352.1|GT2	8.90e-264	1	421	1	452
CDP30616.1|GT2	5.72e-206	1	421	1	451
VBB83821.1|GT2	1.33e-204	1	421	1	451
CAP71217.1|GT2	1.95e-199	44	421	1	402
UNI13454.1|GT2	7.91e-174	17	421	15	417

PDB Hits     

EAQ88138.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O60061|ALG5_SCHPO	1.00e-60	117	418	62	315	Dolichyl-phosphate beta-glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg5 PE=3 SV=1
sp|P40350|ALG5_YEAST	1.28e-57	44	417	26	329	Dolichyl-phosphate beta-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG5 PE=1 SV=1
sp|Q9VLQ1|ALG5_DROME	3.55e-42	117	417	66	317	Dolichyl-phosphate beta-glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=wol PE=1 SV=1
sp|Q9Y673|ALG5_HUMAN	1.85e-40	118	417	66	316	Dolichyl-phosphate beta-glucosyltransferase OS=Homo sapiens OX=9606 GN=ALG5 PE=1 SV=1
sp|Q9DB25|ALG5_MOUSE	2.57e-40	118	421	66	320	Dolichyl-phosphate beta-glucosyltransferase OS=Mus musculus OX=10090 GN=Alg5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000077	0.000002

TMHMM  Annotations     

Start	End
26	48