CAZyme Information: EAQ87742.1

Basic Information

• Species: Chaetomium globosum
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Chaetomium; Chaetomium globosum
• CAZyme ID: EAQ87742.1
• CAZy Family: GH16
• CAZyme Description: Amb_all domain-containing protein [Source:UniProtKB/TrEMBL;Acc:Q2H1I5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
330	CH408032|CGC7	34603.67	6.8346

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglobosumCBS148.51	11232	306901	184	11048

• Gene Location: location=CH408032:2009273-2010639(+)

Full Sequence      

MKLLAAASLLALATASPTPTQPQAGTPRMAKRADVSEAANLGYATLNGGTKGGAGGTVTT
VSTLPQFTEAVNEKNSEPVVVFVKGVISGAAKVRVGSNKSIIGLPGSGFKGVGLHFRKQS
NLIVRNIVSSFVEADQGDALKIEESTNVWVDHCEFYSALVADKDFYDGLVDSSHGSDFIT
ISHTYFHDHWKASLAGHSDSNGGEDTGKLHVTYANNHWKNINSRGPLLRFGTGHIYNSYF
ENMSTAINTRMGAQVLVQSNVFSNVTAPVTSRDSKEVGYATVIDTDLGGGLNDAPKGNMA
TDAVGYQYSLLGSGAVAGKVPGEAGAILTF

Enzyme Prediction     

EC	4.2.2.2:5

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	83	262	3.7e-93	0.988950276243094

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	4.96e-63	83	265	2	189	Amb_all domain.
226384	PelB	4.17e-51	61	326	59	341	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	1.60e-38	92	262	29	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO54996.1|PL1_7	5.29e-191	1	330	1	330
VBB80716.1|PL1_7	4.06e-151	1	330	1	331
CAP61917.1|PL1_7	8.17e-151	1	330	1	331
CDP28992.1|PL1_7	8.17e-151	1	330	1	331
AUT30983.1|PL1_7	5.24e-133	12	330	14	333

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VMV_A	2.26e-42	42	265	6	249	Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]
2QY1_A	3.32e-25	98	326	70	324	Chain A, Pectate lyase II [Xanthomonas campestris pv. campestris],2QY1_B Chain B, Pectate lyase II [Xanthomonas campestris pv. campestris]
2QXZ_A	3.32e-25	98	326	70	324	Chain A, pectate lyase II [Xanthomonas campestris pv. campestris],2QXZ_B Chain B, pectate lyase II [Xanthomonas campestris pv. campestris]
2QX3_A	3.00e-23	98	326	70	324	Structure of pectate lyase II from Xanthomonas campestris pv. campestris str. ATCC 33913 [Xanthomonas campestris pv. campestris],2QX3_B Structure of pectate lyase II from Xanthomonas campestris pv. campestris str. ATCC 33913 [Xanthomonas campestris pv. campestris]
1PCL_A	1.10e-19	36	240	4	246	Chain A, PECTATE LYASE E [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CBV0|PLYB_ASPTN	1.19e-81	9	325	9	322	Probable pectate lyase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyB PE=3 SV=1
sp|Q00645|PLYB_EMENI	7.90e-80	9	325	9	323	Pectate lyase plyB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyB PE=1 SV=1
sp|B8NBC2|PLYB_ASPFN	5.06e-78	1	325	1	323	Probable pectate lyase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyB PE=3 SV=1
sp|Q2TZY0|PLYB_ASPOR	5.06e-78	1	325	1	323	Probable pectate lyase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyB PE=3 SV=1
sp|O59939|PLYB_COLGL	9.40e-77	17	330	22	331	Pectate lyase B OS=Colletotrichum gloeosporioides OX=474922 GN=PLB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000293	0.999704	CS pos: 32-33. Pr: 0.3818

TMHMM  Annotations     

There is no transmembrane helices in EAQ87742.1.