CAZyme Information: EAQ87609.1

Basic Information

• Species: Chaetomium globosum
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Chaetomium; Chaetomium globosum
• CAZyme ID: EAQ87609.1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365		40730.58	9.3170

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglobosumCBS148.51	11232	306901	184	11048

• Gene Location: location=CH408032:1631047-1632314(-)

Full Sequence      

MATFRPPRFRLPKARSAFLKLFLLFLVWTIIEAHISHYRIARTEREAKAKGVLTAPTRVY
IASLHWNNEKILRSEWNKGVVELVKTFGSDNVFVSVYESGSWDDSKGALRELDQELDRLG
VPRKIILDDETHKDLINGPQQEEGWITIPDGKRMPRRIPYLSKLRNLSLQPLRELAMKRD
PCLNHVLSLTFSISSKPTTATTPPPCSLDFSKPPSFYDTFALRDSRGQEHASQTWPYFRS
SKSRNAMVSAEPVRVSSCWNGIASLGIRGLRFRGIPDSLAALHLEASECCLIHADNPGSR
TRGVYVNPAVRVGYNRLAYDAVHNNPTGGGGGGGSWYVVDGGLCGPVAESVGELVYFVVV
CRTEC

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT69	58	297	1.9e-61	0.9916317991631799

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403053	CAP59_mtransfer	1.84e-96	58	292	1	225	Cryptococcal mannosyltransferase 1. The capsule of pathogenic fungi is a complex polysaccharide whose formation is determined by a number of enzymes including, most importantly, alpha-1,3-mannosyltransferase 1, EC:2.4.1.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO60904.1|GT69	2.32e-154	11	325	9	336
AEO66406.1|GT69	4.52e-145	1	328	5	347
EAA27806.1|GT69	2.12e-130	14	323	16	339
CDP31036.1|GT69	4.64e-126	10	323	15	342
CAP71643.1|GT69	4.64e-126	10	323	15	342

PDB Hits     

EAQ87609.1 has no PDB hit.

Swiss-Prot Hits     

EAQ87609.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.395849	0.604147	CS pos: 33-34. Pr: 0.5649

TMHMM  Annotations     

Start	End
21	38