CAZyme Information: EAQ87596.1

Basic Information

• Species: Chaetomium globosum
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Chaetomium; Chaetomium globosum
• CAZyme ID: EAQ87596.1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
446		51105.10	6.9275

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglobosumCBS148.51	11232	306901	184	11048

• Gene Location: location=CH408032:1591168-1592614(+)

Full Sequence      

MIAKLGSPLGAPSLVATAAQFRNRLPTQFRRALPIYIAAVCLILFIFNLNLFQTSGRVPL
SRAPVLGSSADKVRPDFPRKIWQTWKVNPLKFEERDLNTARSWVGKNPDYRYEVLTDDND
LRYVEYHFGPDGFNRPDIVNFYRDVKAAIVKADLLRYMIMYAEGGLYADIDVEALKPLSK
FIPERYAEKDIDMVIGVEIDEPDWKDHPILGPKSRSFCQWTFMCKPQLPVMMRLIEKIMS
WLNGVAKEQGVSLAEVDLDFDQIISGTGPSAFTEAIMIEMDLHKEDPRTKIDWNLFHDLD
ESKVVSRVLVLTVEAFAAGQGHSHSGNHEARAALVRHHYHASNWPSRHPRYSHPAYGEVE
RCNWAPDCKKKEEEEKKKKQKEASERKKKEAEEASRKKKEEEEAASRQKKENEEAEAEKE
KEKQGADKGQEGAEAPQQEKKSGWFS

Enzyme Prediction     

No EC number prediction in EAQ87596.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	97	184	1.1e-19	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	6.78e-23	72	242	77	247	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.57e-13	94	184	2	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO60901.1|GT32	1.52e-236	1	368	1	366
AEO66402.1|GT32	1.85e-235	1	370	1	369
VBB84288.1|GT32	9.77e-229	1	370	1	390
CDP31064.1|GT32	4.83e-227	1	370	151	540
CAP71672.1|GT32	4.83e-227	1	370	151	540

PDB Hits     

EAQ87596.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	3.83e-34	71	317	94	349	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	2.85e-31	76	344	141	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	1.02e-30	77	316	130	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	4.75e-23	78	337	97	463	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	7.18e-08	78	182	58	153	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999990	0.000024

TMHMM  Annotations     

Start	End
32	54