CAZyme Information: EAQ86395.1

Basic Information

• Species: Chaetomium globosum
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Chaetomium; Chaetomium globosum
• CAZyme ID: EAQ86395.1
• CAZy Family: GH1
• CAZyme Description: Rhamnogalacturonan endolyase [Source:UniProtKB/TrEMBL;Acc:Q2GWK6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
642	CH408033|CGC10	70852.26	7.3379

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglobosumCBS148.51	11232	306901	184	11048

• Gene Location: location=CH408033:2500449-2502559(+)

Full Sequence      

MKLCFLSLFPLWADIASATITATESSSSINVKNDRLTFSVSKSAGTINTLTLDGQDLLGS
GGRLYLDCHCDSGYWNGGSFQLYKGTDKSGTAYAGVRISAKVDSGRTFESYYFLRDGETG
LHTFGRAAYPNGGGLGEMRFLFRPSTTIWNHLSSSDEMWSVLPTDAGRTTVQDTTYRISG
DGINAKYRTQMSDYFSKYMFAESWEYHTHHGLFSDGQGTRDGSTYGAWLVMNTKDTYYNG
PKWSDLTVDGIVYNYIISNHHGNGNPDTQKFDRTFGPQYYYFNKGPKGSSVNDLRSDAGR
FADPSWNADFYDSIAQHVPGYLPTSGRGTWNGRIHLPDGVTKAIAVLASNGRDFQDNNLA
TKARQYWGEVSPNGEITIPRVAAGTYRLTVYGTGIFGQYIQDNVVVKAGAATTTTATWTP
ESAGTELWRIGTPDRSSGDFRHGSERDTTRTNKPNQYRLYWAVHDFPKDFPNGVNFHVGK
SDIKRDFNYMQWSVFGGKGNSIRPDPYYTNVNAWNVTFDATSDQLEGKKQATLTIQLAGV
KTSAGNTDDTGKAFANLDYTVTVNGRALPVWTIPANHSSSCGARSAASCYNTRNLWTFDA
SYLKQGLNTFTLALPARATAPESAVLPESVYLQYDALRLEVA

Enzyme Prediction     

EC	4.2.2.23:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL4	18	627	3.7e-261	0.9968354430379747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
199907	RGL4_N	5.20e-47	23	285	4	259	N-terminal catalytic domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold; the middle and C-terminal domains are both putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
199905	RGL4_C	4.45e-30	428	640	1	161	C-terminal domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
199904	RGL4_M	1.08e-28	326	407	1	82	Middle domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle domain represented by this model and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
405384	CBM-like	2.14e-23	427	639	2	157	Polysaccharide lyase family 4, domain III. CBM-like is domain III of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain possesses a jelly roll beta-sandwich fold structurally homologous to carbohydrate binding modules (CBMs), and it carries two sulfate ions and a hexa-coordinated calcium ion.
405387	fn3_3	3.80e-19	337	407	1	68	Polysaccharide lyase family 4, domain II. FnIII-like is domain II of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain displays an immunoglobulin-like or more specifically Fibronectin-III type fold and shows highest structural similarity to the C-terminal beta-sandwich subdomain of the pro-hormone/propeptide processing enzyme carboxypeptidase gp180 from duck. It serves to assist in producing the deep pocket, with domain III, into which the substrate fits.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBY00247.1|PL4_3	1.68e-283	11	642	12	652
QRD05348.1|PL4_3	2.24e-281	5	641	6	651
CCT67126.1|PL4_3	3.78e-235	15	641	20	669
QGI80329.1|PL4_3	1.52e-234	15	641	20	669
QGI63162.1|PL4_3	1.52e-234	15	641	20	669

PDB Hits     

EAQ86395.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U5P7|RGLC_ASPOR	4.18e-215	18	633	21	654	Probable rhamnogalacturonate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rglC PE=3 SV=1
sp|Q5AZ85|RGLB_EMENI	1.19e-213	13	641	13	659	Rhamnogalacturonate lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rglB PE=2 SV=2
sp|Q0C7K7|RGLB_ASPTN	8.87e-211	6	642	7	660	Probable rhamnogalacturonate lyase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=rglB PE=3 SV=1
sp|B8N5T6|RGLB_ASPFN	5.59e-210	13	642	14	663	Probable rhamnogalacturonate lyase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rglB PE=3 SV=1
sp|A1D144|RGLB_NEOFI	9.99e-207	12	641	13	657	Probable rhamnogalacturonate lyase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=rglB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000291	0.999712	CS pos: 18-19. Pr: 0.9315

TMHMM  Annotations     

There is no transmembrane helices in EAQ86395.1.