CAZyme Information: EAQ85870.1

Basic Information

• Species: Chaetomium globosum
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Chaetomium; Chaetomium globosum
• CAZyme ID: EAQ85870.1
• CAZy Family: CE12
• CAZyme Description: GH10 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:Q2GY31]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
149	CH408033|CGC4	16560.94	6.4761

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglobosumCBS148.51	11232	306901	184	11048

• Gene Location: location=CH408033:906685-907134(+)

Full Sequence      

MLKDAGVRIDGVGMQAHLHADNHPTAEDLIATSEGYAALVDEVAFTELDVRIKTPVNDTK
LEWQKECYQKVVTACVKVKACVGITLWDFYDPFSWVPDVFPGNGASLVWFEDFSKHPAYD
GMVETFKKLIGEKPGPGCKRRRRSVGSKA

Enzyme Prediction     

EC	3.2.1.8:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	2	124	1.3e-28	0.3795379537953795

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	4.90e-38	2	124	189	310	Glycosyl hydrolase family 10.
214750	Glyco_10	3.84e-31	2	122	149	263	Glycosyl hydrolase family 10.
226217	XynA	3.33e-11	2	124	213	339	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGH08898.1|GH10	5.81e-83	1	149	222	367
AEO63459.1|GH10	3.42e-73	1	144	220	363
VBB76151.1|GH10	5.10e-69	1	135	219	354
CDP26069.1|GH10	7.22e-69	1	135	219	354
CAP73667.1|GH10	7.22e-69	1	135	219	354

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JDT_A	6.52e-37	1	123	192	314	Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDT_B Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDY_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDY_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDZ_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JDZ_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JE0_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE0_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE1_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE1_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE2_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5],6JE2_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5]
3U7B_A	4.93e-34	1	128	192	326	A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_B A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_C A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_D A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_E A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum]
6Q8M_A	2.59e-33	1	123	214	336	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
1V6Y_A	2.91e-31	3	126	193	314	Crystal Structure Of chimeric Xylanase between Streptomyces Olivaceoviridis E-86 FXYN and Cellulomonas fimi Cex [Streptomyces olivaceoviridis]
1EXP_A	9.05e-31	3	126	191	312	Beta-1,4-Glycanase Cex-Cd [Cellulomonas fimi],1FH7_A Crystal Structure Of The Xylanase Cex With Xylobiose- Derived Inhibitor Deoxynojirimycin [Cellulomonas fimi],1FH8_A Crystal Structure Of The Xylanase Cex With Xylobiose-derived Isofagomine Inhibitor [Cellulomonas fimi],1FH9_A Crystal Structure Of The Xylanase Cex With Xylobiose-derived Lactam Oxime Inhibitor [Cellulomonas fimi],1FHD_A Crystal Structure Of The Xylanase Cex With Xylobiose-derived Imidazole Inhibitor [Cellulomonas fimi],1J01_A Crystal Structure Of The Xylanase Cex With Xylobiose-Derived Inhibitor Isofagomine lactam [Cellulomonas fimi],2EXO_A Crystal Structure Of The Catalytic Domain Of The Beta-1,4- Glycanase Cex From Cellulomonas Fimi [Cellulomonas fimi],2XYL_A Cellulomonas Fimi XylanaseCELLULASE COMPLEXED WITH 2-Deoxy- 2-Fluoro-Xylobiose [Cellulomonas fimi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2PGV8|XYN2_AURPU	4.44e-34	1	129	222	358	Endo-1,4-beta-xylanase 2 OS=Aureobasidium pullulans OX=5580 GN=xynII PE=1 SV=1
sp|B3A0S5|XYNA_FUSO4	2.54e-33	1	128	192	326	Endo-1,4-beta-xylanase A OS=Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) OX=426428 GN=FOXG_17421 PE=1 SV=1
sp|I1RQU5|XYN1_GIBZE	3.16e-32	1	127	208	341	Endo-1,4-beta-xylanase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=XYL1 PE=1 SV=1
sp|O60206|XLNA_AGABI	6.39e-31	2	124	209	329	Endo-1,4-beta-xylanase OS=Agaricus bisporus OX=5341 GN=xlnA PE=2 SV=1
sp|B4XVN1|XYNA_STRSQ	1.01e-30	3	137	229	358	Endo-1,4-beta-xylanase A OS=Streptomyces sp. OX=1931 GN=xynAS9 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000001

TMHMM  Annotations     

There is no transmembrane helices in EAQ85870.1.