CAZyme Information: EAQ85757.1

Basic Information

• Species: Chaetomium globosum
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Chaetomium; Chaetomium globosum
• CAZyme ID: EAQ85757.1
• CAZy Family: CE1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364	CH408033|CGC13	40276.85	6.0113

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglobosumCBS148.51	11232	306901	184	11048

• Gene Location: location=CH408033:541377-542781(+)

Full Sequence      

MLITEKVVDSDKSLLTLVFSLRKVESKYPLVALHTGSLPDKTLRALAARDIPTQRVPYLC
PGPQSEEGGNDDVGRAKDGDSKDHAGGGDTNNDDTWYAKDPRFRVCFTKLAVFSLTAYDR
VVMLDADMLVRRNMDELFDVPLDEEDRLFAATDACVCNPHELPHYPPIWTPANCAYTTQQ
QQQQRTSLLTSSPTTQPQTQHPTRSSTSTTPTPTLNAGLLTLHPSPTTHHTITTFLHHNP
SACTPHHLPFADQSLLSTLFRGRWAALPYVYNALAPMRRSVARGGHGRGGGGDGGDGGVA
PLWRDGEVKAVHYILVPKPWEEGAGSSSGEGEGEGDEDEAETRRWWREVDGERRRWEEER
GIRC

Enzyme Prediction     

No EC number prediction in EAQ85757.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	13	322	2.7e-35	0.8249027237354085

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	2.71e-44	15	349	17	236	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
227884	Gnt1	5.77e-10	99	144	149	194	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
215090	PLN00176	2.31e-09	12	320	37	266	galactinol synthase
133064	GT8_GNT1	5.51e-09	92	141	72	115	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
133037	GT8_A4GalT_like	1.28e-07	118	320	96	246	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO57054.1|GT8	7.41e-75	5	322	5	356
QSS57188.1|GT8	2.30e-65	14	363	35	317
QSS61250.1|GT8	1.71e-63	14	362	116	397
QSS72023.1|GT8	3.50e-61	14	325	35	288
UPL00462.1|GT8	5.68e-61	6	362	9	317

PDB Hits     

EAQ85757.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4PSY4|GOLS7_ARATH	1.04e-07	9	274	31	235	Galactinol synthase 7 OS=Arabidopsis thaliana OX=3702 GN=GOLS7 PE=2 SV=1
sp|Q5UNW1|YR707_MIMIV	4.73e-06	92	138	68	114	Uncharacterized protein R707 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R707 PE=4 SV=1
sp|O43062|YGT9_SCHPO	6.70e-06	102	141	161	200	Uncharacterized protein C4C3.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC4C3.09 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000066	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EAQ85757.1.