CAZyme Information: EAQ85103.1

Basic Information

• Species: Chaetomium globosum
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Chaetomium; Chaetomium globosum
• CAZyme ID: EAQ85103.1
• CAZy Family: AA9
• CAZyme Description: Endo-1,3(4)-beta-glucanase [Source:UniProtKB/TrEMBL;Acc:Q2GSD7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
696		75103.80	7.2138

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglobosumCBS148.51	11232	306901	184	11048

• Gene Location: location=CH408034:2482338-2485243(-)

Full Sequence      

MEWIWRLLFALLTALQFTTSVASPVYLAQQTPPHAALTKSVTVPGPQPTPDAPNAIYRDA
RSTSTPLPRPKRNWNDPPSLEVLTSPAKVITSVGPSGTAQVLASKKTPATGFIPSILDTV
GHVTSVPLLTKPIPKPTSLLAAVSVVVSLKISPSISVKMTARDIFVDPISTDAPPGNIGR
EQDHPVPRLGIQGKGPFETNKFYGNFHRGNQTSPTYLHPYSVAWVRGQGASGSWGLAVSH
VEAHQRVYGQASPVTGAVSYFINPIGIHSVCLSAKELGSDTVLTSEGLTDFSIQVALRPA
PQAAPAVQFPLVQGVGFITAIYDGASPVLQTSVFFRTVTRMTADPKPGVTKYKLQLEDGA
TWLVYARHTQGDPLDLEVVNNGLAQAKGPFYGTIQLAKDPGDGEKVYDQACGAYPVGVQL
SGSVDGAKGTYRFSFKKPGTSDTALAIWTMGESNLPTNIGFLPWSPQAGSVSAISNATRQ
VIHNIAQQEVSQNIIQQLDENSMYFSGKAYVNMLVRDIANPSTQDQYFPLWRCFDWFHGH
SWAHGLSDTLDGNDQESSSEDTMHAYALKMWGSITGDKNLEARSPASCSRTRSTTRTYFG
NRTEDIQGIHMLPLLPHTPLIRTPAFVREEWDTYFSGGREGAITGGWKGVVWGNYATVDP
RGAYAFFAGEGFDPAWLDGGASLTWYLCYSAALGGL

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	192	509	3.3e-61	0.48231511254019294

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397619	Glyco_hydro_81	8.69e-119	184	466	1	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.
227785	Acf2	1.19e-114	128	695	11	757	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	9.69e-100	473	687	1	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO64126.1|GH81	0.0	1	696	1	875
AEO58881.1|GH81	1.59e-270	82	696	18	840
CAP66697.1|GH81	3.44e-244	84	696	169	960
CDP28432.1|GH81	3.44e-244	84	696	169	960
VBB80051.1|GH81	6.29e-233	84	680	169	944

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	8.32e-26	163	664	7	694	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	8.70e-26	163	664	32	719	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	3.38e-25	163	664	7	694	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	7.01e-11	509	580	445	516	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	2.03e-128	159	691	188	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	3.51e-84	163	695	2	704	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|P53753|ENG1_YEAST	1.77e-73	169	693	406	1112	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	1.56e-68	154	693	37	737	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q12168|ENG2_YEAST	2.24e-59	152	692	63	777	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000467	0.999496	CS pos: 22-23. Pr: 0.9546

TMHMM  Annotations     

There is no transmembrane helices in EAQ85103.1.