CAZyme Information: EAQ84727.1

Basic Information

• Species: Chaetomium globosum
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Chaetomium; Chaetomium globosum
• CAZyme ID: EAQ84727.1
• CAZy Family: AA9
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
836		95237.85	6.3227

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglobosumCBS148.51	11232	306901	184	11048

• Gene Location: location=CH408034:1228303-1230898(+)

Full Sequence      

MTQGAIQVLSSGWEFRCETDERWLPVSQVPSNVHTELLNHGLIPDPFKDVNGLEVSWVAE
RTWSYRTRFVTPSNGRVQGSKTDLVFEGLDTFATARLNGKVILQADNMFVEHRVDISNLL
ADVTENTLEITFEPARDRGLELVKAHPEHDFIVHQTEVSRGPVRKAQYHWGWDWGPILLT
CGPWKPVRLECYVSRIEEIKVDYEIHKNRGVPPVLEATIHAHVLGPVAELKADLQFPGGR
VVTLRDRNATPAAPSWRYSSTKFSIEDPDLWWPRGYGPQNLCDVRVRAIASDGSTVLAEE
HQKIGFRKAQLVQEKDQFGQSFYFRVNGVDIFSGGSCWIPADSFLPQIPPKRYQDWIQLL
ADGNQNMIRVWGGGIYEPEVFYAACDELGILVWQDFMFACASYPTYPDYLTSITTEARQN
IRRLRHHPSIILWCGNNEDYQLVERYHLEYNFTTDKDPQSWLKSTFPARYIYEHLLPNLI
HAETPSTPYHPSSPWGNGTSTTLKVDPTVGDIHQWDLWNGEARPWQALPQMGGRFVSEFG
MMGYPAEETLHGFVTDPAERHVGSRTMDFHNKAVVHERRMLGYVGENFRLQAWGRDLGAF
AHLTQVMQADAVGLGYKAWRRGWGGQGQRRCGGVLVWQLNDCWPVVSWAVVDYYLVRKPV
FYAIKRAMAPLAVAVTRKFHDWTARPADELWRRNTGHVDSRKMLTDIELDVWVASSKLEA
AKGKVVVRFVSVRTGEEVRERIEEEVEVQPNGCTEVLTGYKFDWAKATVAEPEHFVIQAA
LWVDGTQVSGDTSWPDPIKYLDFPDRGVTVKDRGQGLIEVSAEKPVKGLRMEGMMS

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	4	770	1.1e-91	0.7300531914893617

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	1.41e-64	6	678	12	639	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407658	Mannosidase_ig	7.28e-08	708	800	2	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
395572	Glyco_hydro_2	1.04e-04	195	307	2	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
397119	Glyco_hydro_2_C	3.88e-04	376	473	60	161	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO64472.1|GH2	0.0	1	828	1	838
AEO59187.1|GH2	0.0	1	828	1	853
QRD07513.1|GH2	0.0	9	828	14	837
QBZ66458.1|GH2	1.50e-313	7	827	6	852
QMW26140.1|GH2	4.72e-305	9	832	9	799

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	1.12e-139	1	675	21	660	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	1.50e-123	6	673	8	656	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	1.57e-123	6	673	10	658	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	1.61e-123	6	673	10	658	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	4.21e-123	6	673	8	656	Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B7W2|MANBB_EMENI	1.10e-267	8	832	8	802	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
sp|Q0CCA0|MANBB_ASPTN	4.84e-261	7	832	7	802	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
sp|A2QYN2|MANBB_ASPNC	1.30e-258	1	832	1	804	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1
sp|Q4WAH4|MANBB_ASPFU	4.96e-256	9	832	9	804	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
sp|B0YBU9|MANBB_ASPFC	9.95e-256	9	832	9	804	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000040	0.000001

TMHMM  Annotations     

There is no transmembrane helices in EAQ84727.1.