CAZyme Information: EAQ84577.1

Basic Information

• Species: Chaetomium globosum
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Chaetomium; Chaetomium globosum
• CAZyme ID: EAQ84577.1
• CAZy Family: AA9
• CAZyme Description: Glucanase [Source:UniProtKB/TrEMBL;Acc:Q2GTW3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421		44230.20	5.0227

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglobosumCBS148.51	11232	306901	184	11048

• Gene Location: location=CH408034:777851-779180(-)

Full Sequence      

MRSFTLLAGLLATASALPAIEPRQSGNPFSGRTLLVNPSYSESLEQTRQALANAGDQTSA
GKVKFVQDKVGTFVWISNIALLADIDKAITNARAAKAKGENPVIGLVLYNIPDRDCSAGE
SSGELSFAQNGLARYKSEYVTPFAQKLKAASDLQFAVVLEPDAMGNMVTGTTAFCQNARG
PQQDGIAYAIQQLQASNVALYLDVANGGWLGWPDNLELTADVVATILQKAGGNNRIRGYA
SNVSNYNPYKSANPPAYTEGSPSPDESRYADNLAAAFGQRGLPTKFIIDQGRVALDGARK
EWGEWCNVYPSGFGQPFTTNTGNNNVDAIVWIKPGGESDGQCGMPGAPRAGAWFDAFAQQ
LAKNAHPDITAGGGNNGGGGNPGGGNCAARWAQCGGQGFTGPTCCSEGTCTVSNQWYSQC
L

Enzyme Prediction     

EC	3.2.1.91:55	3.2.1.4:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	46	343	9.1e-79	0.9625850340136054

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	1.79e-136	56	348	1	293	Glycosyl hydrolases family 6.
227616	CelA1	3.51e-40	3	370	2	444	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].
197593	fCBD	8.48e-13	389	421	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	3.59e-11	390	417	1	29	Fungal cellulose binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB79393.1|CBM1|GH6	7.79e-235	4	421	5	434
CDP27774.1|CBM1|GH6	5.06e-232	4	421	5	429
CAP61420.1|CBM1|GH6	5.06e-232	4	421	5	429
AEO57190.1|GH6	3.50e-134	1	369	1	377
AGY80095.1|GH6	4.08e-134	15	369	3	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1DYS_A	9.88e-197	24	369	1	346	Endoglucanase CEL6B from Humicola insolens [Humicola insolens],1DYS_B Endoglucanase CEL6B from Humicola insolens [Humicola insolens]
3A64_A	4.66e-87	19	369	5	379	Chain A, Cellobiohydrolase [Coprinopsis cinerea],3A9B_A Chain A, Cellobiohydrolase [Coprinopsis cinerea],3ABX_A Chain A, Cellobiohydrolase [Coprinopsis cinerea]
3VOF_A	7.36e-86	19	369	5	379	Chain A, Cellobiohydrolase [Coprinopsis cinerea]
3VOG_A	6.72e-84	25	371	6	364	Chain A, Cellobiohydrolase [Coprinopsis cinerea],3VOH_A Chain A, Cellobiohydrolase [Coprinopsis cinerea],3VOI_A Chain A, Cellobiohydrolase [Coprinopsis cinerea]
3VOJ_A	1.06e-82	25	371	6	364	Chain A, Cellobiohydrolase [Coprinopsis cinerea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B2ADA5|GH6D_PODAN	8.98e-233	4	421	5	429	Probable exoglucanase GH6D OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=GH6D PE=3 SV=1
sp|Q7SIG5|GUN6_HUMIN	5.08e-196	24	369	1	346	Endoglucanase-6B OS=Humicola insolens OX=34413 GN=cel6B PE=1 SV=1
sp|B2AC20|CEL6B_PODAN	1.27e-133	1	369	30	411	1,4-beta-D-glucan cellobiohydrolase CEL6B OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=CEL6B PE=1 SV=1
sp|P49075|GUX3_AGABI	8.62e-89	25	369	88	438	Exoglucanase 3 OS=Agaricus bisporus OX=5341 GN=cel3 PE=1 SV=1
sp|A2QYR9|CBHC_ASPNC	9.01e-81	13	367	86	457	Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=cbhC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000297	0.999693	CS pos: 23-24. Pr: 0.9547

TMHMM  Annotations     

There is no transmembrane helices in EAQ84577.1.