CAZyme Information: EAQ84453.1

Basic Information

• Species: Chaetomium globosum
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Chaetomium; Chaetomium globosum
• CAZyme ID: EAQ84453.1
• CAZy Family: AA7
• CAZyme Description: SGNH_hydro domain-containing protein [Source:UniProtKB/TrEMBL;Acc:Q2GU87]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
187	CH408034|CGC23	20238.30	6.9774

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglobosumCBS148.51	11232	306901	184	11048

• Gene Location: location=CH408034:391007-391877(-)

Full Sequence      

MHVSSIISAFSLASLALASPVEVVERQAQKLKITGWDQHHEGHSGWLAVDIANNYLTNWL
KSTPADIVMFMLGTNDVVRGKTTDDVIAAYTKMVNIIRAANPKTKIIVDLVIPLSFSNAP
IQAINARIPAWAAGLNTTESPIVVADCYTGFQTSYLRDGVHPNLDGDRVIASRVGPLLLD
YVKASLA

Enzyme Prediction     

No EC number prediction in EAQ84453.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	22	172	2.6e-39	0.7835051546391752

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	3.96e-40	33	171	10	150	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	7.89e-15	42	166	40	173	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	1.54e-11	7	177	8	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238866	sialate_O-acetylesterase_like2	3.42e-11	62	178	46	168	sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238879	NnaC_like	1.26e-09	66	172	53	168	NnaC (CMP-NeuNAc synthetase) _like subfamily of SGNH_hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases. E. coli NnaC appears to be involved in polysaccharide synthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO59370.1|CE3	1.09e-100	1	186	1	233
AEO64701.1|CE3	2.65e-87	1	187	1	235
VBB79507.1|CE3	5.24e-81	1	187	60	292
CDP27869.1|CE3	5.24e-81	1	187	60	292
CAP61514.1|CE3	5.24e-81	1	187	60	292

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5B5L_A	1.44e-49	12	183	25	204	Crystal structure of acetyl esterase mutant S10A with acetate ion [Talaromyces cellulolyticus]
5B5S_A	1.44e-49	12	183	25	204	Crystal structure of a carbohydrate esterase family 3 from Talaromyces cellulolyticus [Talaromyces cellulolyticus]

Swiss-Prot Hits     

EAQ84453.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001184	0.998764	CS pos: 26-27. Pr: 0.7983

TMHMM  Annotations     

There is no transmembrane helices in EAQ84453.1.