CAZyme Information: EAQ84383.1

Basic Information

• Species: Chaetomium globosum
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Chaetomium; Chaetomium globosum
• CAZyme ID: EAQ84383.1
• CAZy Family: AA7
• CAZyme Description: GH16 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:Q2GUF7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
284	CH408034|CGC21	30504.41	6.1446

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglobosumCBS148.51	11232	306901	184	11048

• Gene Location: location=CH408034:192566-193580(+)

Full Sequence      

MRSTLLLLSLLTSLVSATPAPVYPGFKTLWSEAFEGNAGDTPNRSRWNLITDVRTNGEIQ
TYSTSNRNLQISGGGTVQLVPLKSKSGKWTSARIETKATFTPARGKLTMFEAAIRFGDNP
ASLRQGLWPAFWMLGDAVHHGTEWPLCGELDIMETVNGLPTAHGTTHCGVGEKGGPCNEP
IGRGGSVALPDNGWHTWTLQVDRTNAEGGWKGEVIRWLIDGKVFHQVSGADLGDEGIWAT
LAHSPMFMILNVAVGGSWPGDPNAATAGSYGSMMEVEYVAVYSS

Enzyme Prediction     

EC	3.2.1.6:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	30	282	3.8e-55	0.9956521739130435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185691	GH16_Strep_laminarinase_like	1.76e-131	25	283	1	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
185693	GH16_laminarinase_like	2.36e-49	30	282	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185683	Glyco_hydrolase_16	2.54e-20	34	282	3	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
225182	BglS	6.23e-13	61	284	75	265	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185687	GH16_beta_agarase	2.47e-12	39	282	31	257	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATJ00809.1|GH16_3	4.27e-215	1	283	1	283
AEO59417.1|GH16_3	1.06e-165	1	284	1	284
AEO64760.1|GH16_3	2.05e-163	3	284	4	285
CDP27813.1|GH16_3	1.73e-132	4	284	5	287
VBB79446.1|GH16_3	1.73e-132	4	284	5	287

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EO3_A	1.42e-51	21	284	5	280	Chain A, 1,3-beta-glucanase [Actinomycetia bacterium]
3DGT_A	2.77e-47	17	283	1	275	The 1.5 A crystal structure of endo-1,3-beta-glucanase from Streptomyces sioyaensis [Streptomyces sioyaensis]
3ATG_A	7.65e-44	29	284	6	240	endo-1,3-beta-glucanase from Cellulosimicrobium cellulans [Cellulosimicrobium cellulans]
2HYK_A	1.38e-37	29	282	10	242	The crystal structure of an endo-beta-1,3-glucanase from alkaliphilic Nocardiopsis sp.strain F96 [Nocardiopsis sp. F96]
2VY0_A	1.07e-25	26	283	13	260	The X-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus],2VY0_B The X-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q27082|CFGA_TACTR	8.72e-14	24	282	23	252	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
sp|Q9ZG90|KSBGL_SPHMU	6.46e-10	90	282	133	287	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
sp|O33680|EXSH_RHIME	1.30e-08	30	283	244	458	Endo-1,3-1,4-beta-glycanase ExsH OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exsH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000214	0.999744	CS pos: 17-18. Pr: 0.9855

TMHMM  Annotations     

There is no transmembrane helices in EAQ84383.1.