CAZyme Information: EAQ83401.1

Basic Information

• Species: Chaetomium globosum
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Chaetomium; Chaetomium globosum
• CAZyme ID: EAQ83401.1
• CAZy Family: AA2|AA2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
227	CH408035|CGC7	23971.69	4.5232

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglobosumCBS148.51	11232	306901	184	11048

• Gene Location: location=CH408035:718379-719182(-)

Full Sequence      

MKLTLATAVLAAALAEAHYTFPSVDDSADWQYVRTTTNYQSNGPVTDVTSDQIRCYERDP
GTGAPETYSVTAGKVLNYNAKASVSHPGPMAFYIAKVPEGETAATWDGSGEVWSKIYQEM
PEFGASMTWSSDGAKSIPVTIPSCLSDGEYLLRVEHIALHSAGSAGGAQFYLSCAQLSVT
GGSGSWSPKSKVAFPGAYSATDPGILINIYYPVPTSYTPPGPAVESC

Enzyme Prediction     

EC	1.14.99.54:5	1.14.99.56:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA9	5	212	3.1e-69	0.9954545454545455

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
410622	LPMO_AA9	2.62e-83	18	224	1	215	lytic polysaccharide monooxygenase (LPMO) auxiliary activity family 9 (AA9). AA9 proteins are copper-dependent lytic polysaccharide monooxygenases (LPMOs) involved in the cleavage of cellulose chains with oxidation of carbons C1 and/or C4 and C6. Activities include lytic cellulose monooxygenase (C1-hydroxylating) (EC 1.14.99.54) and lytic cellulose monooxygenase (C4-dehydrogenating) (EC 1.14.99.56). The family used to be called GH61 because weak endoglucanase activity had been demonstrated in some family members.
397484	Glyco_hydro_61	3.76e-69	19	217	1	211	Glycosyl hydrolase family 61. Although weak endoglucanase activity has been demonstrated in several members of this family, they lack the clustered conserved catalytic acidic amino acids present in most glycoside hydrolases. Many members of this family lack measurable cellulase activity on their own, but enhance the activity of other cellulolytic enzymes. They are therefore unlikely to be true glycoside hydrolases. The subsrate-binding surface of this family is a flat Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO68157.1|AA9	2.70e-135	1	227	1	227
AEO59836.1|AA9	5.44e-135	1	227	1	227
CDP29378.1|AA9	3.73e-126	1	227	1	227
VBB81154.1|AA9	4.61e-126	1	227	47	273
CAP64865.1|AA9	3.34e-117	20	227	48	255

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3EII_A	5.22e-90	18	227	1	208	Zinc-bound glycoside hydrolase 61 E from Thielavia terrestris [Thermothielavioides terrestris],3EII_B Zinc-bound glycoside hydrolase 61 E from Thielavia terrestris [Thermothielavioides terrestris],3EII_C Zinc-bound glycoside hydrolase 61 E from Thielavia terrestris [Thermothielavioides terrestris],3EII_D Zinc-bound glycoside hydrolase 61 E from Thielavia terrestris [Thermothielavioides terrestris],3EJA_A Magnesium-bound glycoside hydrolase 61 isoform E from Thielavia terrestris [Thermothielavioides terrestris],3EJA_B Magnesium-bound glycoside hydrolase 61 isoform E from Thielavia terrestris [Thermothielavioides terrestris],3EJA_C Magnesium-bound glycoside hydrolase 61 isoform E from Thielavia terrestris [Thermothielavioides terrestris],3EJA_D Magnesium-bound glycoside hydrolase 61 isoform E from Thielavia terrestris [Thermothielavioides terrestris]
4QI8_A	9.36e-85	18	227	1	214	Lytic polysaccharide monooxygenase 9F from Neurospora crassa, NcLPMO9F [Neurospora crassa],4QI8_B Lytic polysaccharide monooxygenase 9F from Neurospora crassa, NcLPMO9F [Neurospora crassa]
4B5Q_A	3.75e-52	18	224	1	214	Chain A, GLYCOSIDE HYDROLASE FAMILY 61 PROTEIN D [Phanerodontia chrysosporium],4B5Q_B Chain B, GLYCOSIDE HYDROLASE FAMILY 61 PROTEIN D [Phanerodontia chrysosporium]
7EXK_A	1.20e-50	18	224	1	214	Chain A, Glycoside hydrolase family 61 protein [Gelatoporia subvermispora B],7EXK_B Chain B, Glycoside hydrolase family 61 protein [Gelatoporia subvermispora B],7EXK_C Chain C, Glycoside hydrolase family 61 protein [Gelatoporia subvermispora B],7EXK_D Chain D, Glycoside hydrolase family 61 protein [Gelatoporia subvermispora B],7EXK_E Chain E, Glycoside hydrolase family 61 protein [Gelatoporia subvermispora B],7EXK_F Chain F, Glycoside hydrolase family 61 protein [Gelatoporia subvermispora B]
5TKF_A	5.90e-41	42	227	26	223	Neurospora crassa polysaccharide monooxygenase 2 high mannosylation [Neurospora crassa],5TKF_B Neurospora crassa polysaccharide monooxygenase 2 high mannosylation [Neurospora crassa],5TKF_C Neurospora crassa polysaccharide monooxygenase 2 high mannosylation [Neurospora crassa],5TKF_D Neurospora crassa polysaccharide monooxygenase 2 high mannosylation [Neurospora crassa],5TKG_A Neurospora crassa polysaccharide monooxygenase 2 resting state [Neurospora crassa],5TKG_B Neurospora crassa polysaccharide monooxygenase 2 resting state [Neurospora crassa],5TKH_A Neurospora crassa polysaccharide monooxygenase 2 ascorbate treated [Neurospora crassa],5TKH_B Neurospora crassa polysaccharide monooxygenase 2 ascorbate treated [Neurospora crassa],5TKI_B Neurospora crassa polysaccharide monooxygenase 2 resting state joint X-ray/neutron refinement [Neurospora crassa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DBS6|EGLD_NEOFI	1.52e-25	1	224	1	231	Probable endo-beta-1,4-glucanase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglD PE=3 SV=1
sp|B0Y9G4|EGLD_ASPFC	1.53e-24	1	224	1	231	Probable endo-beta-1,4-glucanase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglD PE=3 SV=1
sp|Q4WBU0|EGLD_ASPFU	1.53e-24	1	224	1	231	Probable endo-beta-1,4-glucanase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglD PE=3 SV=1
sp|A2R5N0|EGLD_ASPNC	4.36e-24	11	224	14	234	Probable endo-beta-1,4-glucanase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=eglD PE=3 SV=1
sp|Q2US83|EGLD_ASPOR	7.14e-24	11	224	14	231	Probable endo-beta-1,4-glucanase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000226	0.999735	CS pos: 17-18. Pr: 0.8571

TMHMM  Annotations     

There is no transmembrane helices in EAQ83401.1.