CAZyme Information: EAQ83124.1

Basic Information

• Species: Chaetomium globosum
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Chaetomium; Chaetomium globosum
• CAZyme ID: EAQ83124.1
• CAZy Family: AA11
• CAZyme Description: Mannan endo-1,6-alpha-mannosidase [Source:UniProtKB/TrEMBL;Acc:Q2GM62]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
453	CH408036|CGC3	48868.91	5.0612

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglobosumCBS148.51	11232	306901	184	11048

• Gene Location: location=CH408036:696655-698277(-)

Full Sequence      

MGWTTAPKATALLGALLLAAPGASAQAAKLKVDLDSPSSIRSAAKVVAANLMTYYHGDEP
GQTPGILPGPPPAAPYYWWQAGAMWGTIVDYWFYTGDNQYNAEALRSMVFQAEAPVNAYM
PRNWTASLGNDDQGFWGMAAMLAAEVNFPNPPEDQPQWLALAQAVFNTQVVRWETADCAG
GLRWQVEHTNGGYDYKNTIANGRVPQHRLAPGPLHPERDDYNVMDGGHIPFNCTDVNPVQ
FSANAAILIHAAAVMYNYTEGNARTKWKGRVAGLLNRTVEHFFPDGIMIERACELEDRVQ
CNTDQHSFKGYMHRALATVAVLAPFTYDDVLKTLRSSTEGAVTSCLSDGTCGFRWNTGEY
DNDVAAGPAGQQMSALAALSTLLIDQQKVLNGPLTNQTGGTSKGDPNAGQKFQGLSPPRE
ITAGDRAGSGILTAVVLASFLGSVVWMGMSWSE

Enzyme Prediction     

EC	3.2.1.101:1	3.2.1.101:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	37	202	2.6e-45	0.41620111731843573
GH76	219	397	3.7e-35	0.44972067039106145

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	6.04e-140	39	376	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO60096.1|GH76	1.68e-260	6	453	2	469
AEO67877.1|GH76	5.21e-234	1	453	1	469
VBB81200.1|GH76	8.85e-216	1	447	1	462
CDP29412.1|GH76	2.05e-204	33	447	35	460
CAP65200.1|GH76	2.05e-204	33	447	35	460

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	3.72e-116	34	426	30	443	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q75DG6|DCW1_ASHGO	5.82e-99	17	447	14	449	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|P36091|DCW1_YEAST	3.44e-97	30	447	22	447	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	6.06e-91	30	447	19	444	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|O74556|YCZ2_SCHPO	3.72e-88	30	409	20	407	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q05031|DFG5_YEAST	4.62e-87	30	447	27	456	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000233	0.999760	CS pos: 25-26. Pr: 0.9790

TMHMM  Annotations     

There is no transmembrane helices in EAQ83124.1.