CAZyme Information: EAQ83060.1

Basic Information

• Species: Chaetomium globosum
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Chaetomium; Chaetomium globosum
• CAZyme ID: EAQ83060.1
• CAZy Family: AA11
• CAZyme Description: GMC_OxRdtase_N domain-containing protein [Source:UniProtKB/TrEMBL;Acc:Q2GMC6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
577		61625.65	5.1414

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglobosumCBS148.51	11232	306901	184	11048

• Gene Location: location=CH408036:500043-501922(+)

Full Sequence      

MVSVDLSQPFDYVVIGGGTAGLVVANRLTEDSSVRVLVVEAGADRTADPLVLTPGLVGAL
YGKEEYDWNFISPPQPTLNNRRINQARGKMLGGSSALNFLMLLYPSKGNIDAWAALGNPS
WNYDALAPYLRKFATVHPSPQSARDLLGLTYLNEDLAKGDGPIQVSHTEGYGVTNKAWLQ
TFAGLGLEAASDPREGGALGAFQNHASIDPATNTRSYACTGYYTPEVAKRPNLVVLTETV
VNKIIFDTTSGEDAVATGVEIITKDGQKKQVSASTEVILAAGSLQSPQILELSGVGGRDL
LGKHGIPVIVENPNVGEHVQDHPIVCQSFEVADGVPSGDVLRDPNVLQALVGMYQTGGAG
PLGQSVISVAYSPLVDGSGIVPAEAKASLFAEHAPTFDTPEGKVARKLVESPTEATFQYL
LFPSQPFSRGSVHITSADVHAPPEWDPKYNSNPLDMELLARAVQFVERIVDPATPFGGVL
KAGGQRQPALKADDLDTAREIVRRRQISVFHVAGSCAMRPRDQGGVVDERLRVYGTKRLR
VVDASVFPIEPVGNIQSVVYAVAERAADFIKEDRARA

Enzyme Prediction     

No EC number prediction in EAQ83060.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	9	573	2.3e-172	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.21e-92	7	571	3	532	choline dehydrogenase; Validated
225186	BetA	1.45e-90	3	577	1	540	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.51e-35	426	566	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	8.56e-28	10	559	56	565	Protein HOTHEAD
366272	GMC_oxred_N	1.16e-26	76	324	12	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO60130.1|AA3_2	0.0	1	577	2	611
CAD60572.1|AA3_2	0.0	1	574	1	605
CDP29465.1|AA3_2	0.0	1	574	1	605
VBB81258.1|AA3_2	0.0	1	574	1	605
UKZ60559.1|AA3_2	2.56e-244	7	574	5	600

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	3.97e-75	7	573	3	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	1.64e-66	5	573	1	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
3Q9T_A	1.18e-61	10	573	7	572	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	1.18e-61	10	573	7	572	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	2.29e-61	10	573	7	572	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A142PTM2|CITC_MONPU	8.97e-93	6	573	10	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	8.97e-93	6	573	10	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	1.41e-90	6	573	10	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	4.81e-87	7	573	37	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.06e-75	8	570	45	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000002	0.000049

TMHMM  Annotations     

There is no transmembrane helices in EAQ83060.1.