CAZyme Information: CXQ87_004408-t45_1-p1

Basic Information

• Species: [Candida] duobushaemulonis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] duobushaemulonis
• CAZyme ID: CXQ87_004408-t45_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366		38541.70	6.0322

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CduobushaemulonisB09383	5329	N/A	156	5173

• Gene Location: location=PKFP01000006:356455-357555(-)

Full Sequence      

MLFKSIVQAAIVASAIAQPLHQHHQHEKKAVVTNWNTVFVTQTAGAPQATEAADEEPQTT
AEAQAAGIIGDIIGGGKSSASASSSSASAPSKPSASSSDSVSLPSSSGSFSGPAKGITYS
PYSDDGGCKSSSQIKSDIQKLSDYETIRLYGVDCNQVEATLSGLSKGQKIFAGIFEVDNI
KSDVETLAKAVKNHGGWDVVHTVSIGNELVNAGSATPAQVGKYVSEGKSALKAQGYTGPV
VNVDTFIAVINNPDLCEHSDYMAVNAHAFFDGHVSAKEAGDWVLLQLQRVSNACKDKKKV
FITETGWPTKGDSNKVAVPSSDNQKAALQSISDKCGNDVTFFNAYNDMWKKPGSYNAEQY
WGVYSS

Enzyme Prediction     

No EC number prediction in CXQ87_004408-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	116	365	1.5e-25	0.9581993569131833

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	2.08e-96	114	366	45	303	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	9.62e-05	124	366	12	299	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWU89642.1|GH17	2.04e-252	1	366	1	366
QEO21484.1|GH17	5.76e-168	103	366	100	363
QRG37253.1|GH17	5.76e-168	103	366	100	363
QWW21518.1|GH17	5.76e-168	103	366	100	363
QEL58275.1|GH17	5.76e-168	103	366	100	363

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.18e-10	128	366	49	284	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59XX2|MP65_CANAL	3.55e-124	1	366	1	378	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|Q04951|SCW10_YEAST	3.11e-107	114	366	136	388	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|P53334|SCW4_YEAST	5.19e-105	109	366	128	385	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|P53189|SCW11_YEAST	7.99e-50	115	363	282	537	Probable family 17 glucosidase SCW11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW11 PE=1 SV=1
sp|Q0CEX9|BTGE_ASPTN	1.00e-43	116	362	304	553	Probable beta-glucosidase btgE OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=btgE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000399	0.999568	CS pos: 17-18. Pr: 0.9643

TMHMM  Annotations     

There is no transmembrane helices in CXQ87_004408-t45_1-p1.