CAZyme Information: CXQ87_004087-t45_1-p1

Basic Information

• Species: [Candida] duobushaemulonis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] duobushaemulonis
• CAZyme ID: CXQ87_004087-t45_1-p1
• CAZy Family: GT33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396		44999.22	7.3514

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CduobushaemulonisB09383	5329	N/A	156	5173

• Gene Location: location=PKFP01000004:1130069-1131259(-)

Full Sequence      

MSLTNPNLEGYAITRGMWLYFYNPNKKTFKAPKKCSGCYNSDTFVVWAVSVAAQAVVDGA
RIYPELKPLIGPAIDTFQRYKNKHTKGFSAAENGGNDTDIYYDDDAQVASAMLTAYEVTG
EKRFLDQGRELTRFLMGGWHPKIGGVKWHVSKTYVNACTTAEVAKACLQCSKFIPDEAQT
YIDFAAKCIQWQIDTLQDKKDKCIIDGVQPDGMKFEKGKLTYNTGTTLSCAAHLWHITKD
EKWKNIADDLAKASIDHNVPFFDRDYPMELRYWRDSNYWTQLLIEGLADYLLYVGNDAPE
GLPKAIHDEVLRNILMYYKYAKDPQDGLYIQTFEPHGTFPEKADLYKEEFKGKKKVGFKR
EDSDGGKPQKCLMGLGAAARCFFQAARIIPEIHYNN

Enzyme Prediction     

No EC number prediction in CXQ87_004087-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	12	323	3.8e-49	0.8212290502793296

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	7.58e-26	96	289	80	290	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	1.02e-10	82	261	72	251	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWU89116.1|GH76	1.25e-309	1	396	1	396
QWW24611.1|GH76	1.96e-272	1	395	1	396
QEO23230.1|GH76	1.96e-272	1	395	1	396
QEL61860.1|GH76	1.96e-272	1	395	1	396
QRG39687.1|GH76	5.62e-272	1	395	1	396

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C1S_A	2.09e-17	88	253	95	267	Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],4C1S_B Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
6U4Z_A	5.47e-14	88	253	219	391	Crystal Structure of a family 76 glycoside hydrolase from a bovine Bacteroides thetaiotaomicron strain [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14131|MU191_SCHPO	5.82e-36	35	389	35	414	Meiotically up-regulated gene 191 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug191 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999927	0.000096

TMHMM  Annotations     

There is no transmembrane helices in CXQ87_004087-t45_1-p1.