CAZyme Information: CXQ87_003799-t45_1-p1

Basic Information

• Species: [Candida] duobushaemulonis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] duobushaemulonis
• CAZyme ID: CXQ87_003799-t45_1-p1
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1426	PKFP01000004|CGC4	163617.47	5.3357

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CduobushaemulonisB09383	5329	N/A	156	5173

• Gene Location: location=PKFP01000004:443719-447999(+)

Full Sequence      

MLISRFWTIAAATAVSIKLTADWSEASFPEQLIEAASSYKDSLYVSAVRALYQNEESLDW
EDDDFDDVEIGSETGSRTDKQIYDSFVGSLSPEEKGMADLNLVNKIYTPRIEAHYRHYQN
EVDESKVLKACAKDSFGNEIEDPLGAWVKYGDRIYCSDADLYALQLSRTSEEIKAFDRVI
GNDEKKPLLVLYGSSKSPRLGQMFETLYQFAESDKLRFMWRYVPTEGPKSEIPGFGAILT
PKKPLNGTKSSKIKYTGDIKKYLADIRKRGQPLKALEEDSYQELSVKITALVLAQPEAEQ
HELLQEILNNLPLYGPYIQLIRDISGLESTRAAAKVNENRGASAESVGLYLNGASVHKLE
MDLPHVINKLNTELRLAQRMSELGFSKAQSKFIFYKFALMSAFREVQYRTGDQENRYAVY
KHAFDPTDNTSGGVVYFNDIEKDDPYDLFDVNRREAYLGVEAQRLQFGQVPALRENSHEL
IFAINFSSSIQVKIFFTFAKIILDRNLPQQIAVVPLVDSDEDELVTEKFYHIMEVSDSKE
AFALLYQYYEAPTQEEKHEILSKVEVSEDKQGTFRNYEKTVREFSLDSPSVIINGVIHDM
KSPWQAAMTKQMGNDVRLLQQKIKKMEDRGRDLKSVLFQDAKESRNSRVSPKDLSNIRYK
EVTKELIDNSSAFKKINKPNDAPGTFWLIGDFNSRLILAQFSKLLELLEIYSDMSLEIRI
LNISDDDSLLNKLSAKYGAKPLTHETITDLKSEVLKAKSKVYSKVSPKKAQLLQDHQIQL
HQPGMLFNSRYLKLNDLFDTEELIELVGFEHRRRLSIFKDITDTYPDMFSWKGIMFFRKS
GYDNFEWFDLVSSVVAKSFFLEDSQIQTDVDRFDFSSLNFVNSLNITGANGASVDILAIV
DPISDVSQKIVSIVSALKDLPFVNVKLLIQPLKDVAEHTSLERFYAHNFVSSYPQFDEDG
TFSISNYGAQAQGLVPKYKFSSDLDIPSRWLVVKDKLPKADHEEFTVDEIEELSYKLDKL
VVEGYAKDVKTAQSIATLTFDITNEQVVEDGIVMHTLGYVQFQLKPDVWSLSIQRGSRGE
QIYNLLSASDNKYDTNDQPIDTAEVSLFSLHGSVIHPRLLEKSEKDQAKAKKKVSTTKNA
DINVFSLASGKLYERFVSTMMLSVKKHTKSTVKFWLLRNFLSAEFVDSLPQLAEAYGFQY
ELITYKWPLWLRQQKEKYRQVWGYKILFLDVLFPNSLDKVIFVDADQTARTDLKELVDTD
LKGKVYGFPPMCDSRKEVEGYRFWKQGYWKNVLQDDLKYHISALFVVDLNAFRQEYAGDR
LRSHYQKLSSDKESLANLDQDLPNNMQRSIPIHTLKQDWLWCETWCSDESKKKAKMIDLC
SDPFRKETKLERVQRSIPEWKGYDDQIQRLQKGESDTGANVGHDEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1142	1390	5e-119	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1142	1410	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	2.71e-148	1142	1390	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
132996	Glyco_transf_8	1.57e-50	1142	1383	1	241	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
408201	Thioredoxin_14	7.35e-31	424	649	1	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
408199	Thioredoxin_12	3.84e-28	27	231	3	185	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWU89367.1|GT24	0.0	1	1426	1	1426
QRG38164.1|GT24	0.0	9	1426	11	1441
QWW23236.1|GT24	0.0	1	1426	1	1442
QEL60276.1|GT24	0.0	9	1426	11	1441
QEO20323.1|GT24	0.0	9	1426	11	1441

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	2.02e-148	9	1410	5	1447	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	2.02e-148	9	1410	5	1447	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	1.39e-147	9	1410	5	1447	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	3.66e-134	883	1410	645	1213	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6FSN_A	3.30e-120	1126	1410	1	284	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila],7ZHB_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila],7ZKC_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	2.30e-131	205	1407	184	1421	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q9NYU2|UGGG1_HUMAN	1.56e-120	895	1419	988	1535	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q6P5E4|UGGG1_MOUSE	2.10e-118	895	1411	988	1524	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9JLA3|UGGG1_RAT	2.47e-117	895	1411	988	1524	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2
sp|Q9NYU1|UGGG2_HUMAN	9.24e-112	182	1410	177	1498	UDP-glucose:glycoprotein glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=UGGT2 PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.963793	0.036247

TMHMM  Annotations     

There is no transmembrane helices in CXQ87_003799-t45_1-p1.