CAZyme Information: CXQ87_003485-t45_1-p1

Basic Information

• Species: [Candida] duobushaemulonis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] duobushaemulonis
• CAZyme ID: CXQ87_003485-t45_1-p1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420		48253.85	8.9796

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CduobushaemulonisB09383	5329	N/A	156	5173

• Gene Location: location=PKFP01000003:1352026-1353288(-)

Full Sequence      

MKITTEQLFILGVLLRIGFFLFGLFQDKYMAVRYTDIDYVVFSDAAKYVADDKSPYQRET
YRYTPMLAWILLPVTFGGNWAHYGKAVFMLCDIITGALITEVLKKETPGSSTKDTFFQRN
KTTILSAIWLLNPMVITISTRGSSESVLSCFIMLAVANLFRDQYIMSALFLGLSIHFKIY
PIIYLPSIMLFLASKKPSLIKAWQNVPFLGWVNTTNLTYLVATLASFAVPTYLMYDFYGY
EFLYHSYLYHLTRLDHRHNFSLYNLALYLKSAQDYLPQNLDSENLLTIALQSIEKAAFAP
QIILSGLVIPLVLARRNLTACFFIQTLTFVTFNKVMTSQYFIWFLIFLPSYLATSQLLSK
SNARKGSLMLLLWIASQGMWLFFAYKLEFLGESTFTELLFSSSIFFLVNCWLIGEFIALA

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	138	417	4.8e-88	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	1.72e-75	3	417	6	415	GPI mannosyltransferase
252941	Mannosyl_trans	8.27e-71	138	417	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWU88835.1|GT50	2.12e-254	1	377	1	377
QEO20435.1|GT50	3.70e-185	3	420	4	422
QRG39151.1|GT50	5.24e-185	3	420	4	422
QEL61505.1|GT50	1.50e-184	3	420	4	422
QWW23894.1|GT50	8.44e-172	3	404	4	406

PDB Hits     

CXQ87_003485-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6BHI9|GPI14_DEBHA	9.24e-145	1	417	2	407	GPI mannosyltransferase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GPI14 PE=3 SV=2
sp|Q5AMR5|GPI14_CANAL	8.00e-132	6	417	5	395	GPI mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPI14 PE=3 SV=1
sp|P47088|GPI14_YEAST	5.85e-98	4	417	2	386	GPI mannosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPI14 PE=1 SV=2
sp|Q6FXQ5|GPI14_CANGA	5.48e-97	2	417	3	393	GPI mannosyltransferase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=GPI14 PE=3 SV=1
sp|Q4I073|GPI14_GIBZE	1.18e-96	3	418	8	406	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000015	0.000013

TMHMM  Annotations     

Start	End
7	26
61	83
122	144
164	186
207	229
297	319
340	359
369	391
398	419