CAZyme Information: CXQ87_003106-t45_1-p1

Basic Information

• Species: [Candida] duobushaemulonis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] duobushaemulonis
• CAZyme ID: CXQ87_003106-t45_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
975	PKFP01000003|CGC2	108316.32	4.6120

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CduobushaemulonisB09383	5329	N/A	156	5173

• Gene Location: location=PKFP01000003:500278-503503(-)

Full Sequence      

MELDPDSLDSVCEAAEHIVQGQINYYEGLSYGGTVGGFVAPYYWWHAGEVFGGWVDYWHF
CKPDNETFEKILSDAMLHQAGSKWDYMPSNQSMTEGNDDQGIWGLALLQAAERNFTDHED
HSWLSLAQAIYNQMSSRWDDTTCNGGLRWQIFTWNSGYNYKNSISNGCFFHIAARLYRYT
DDDRYLKEAEKIWDWMWGVGFMKYKEENDDFIIYDGADDQTNCTDLTVHRWSYIYGVFLG
GCAYLYNATGDDIWKERVEEILVATDDYFYNNSILIEKTCAPWGRCNTDQRFFLALLTRN
MGLTATLIPSMHDHIRDKMLKKSAVAAAQSCSGGDDGVTCGQNWNYNGWDGKFGLGEQTN
ALETIMTMITTDHVPYTADTGGSSKSVPDSGNHSTTSVNNNVFDVATKDRAGAAVLTAVV
LGLTLSGDESSSFFMGQDDGSDVASISSSRSLPSTLSSLPTSEDQESFHSWLQEEHARRY
SAINDNESQERRSYGSRSSRPSTKTGGALVGIEDFGRLRTTNSREGRMLLRYSLPLIVTF
VLEHFFSIVCLLVVGHLGKNELAAVSLGSMTSTISLAIFEGIATALDTLCPQAYGAGNLE
MVSVHVQRCMMFSMLVFIPVALFWWNCHYLLRYVIQEQQVLELTTLFLRIFILGGPPYIF
FECFKRFLQAQGIFEAGTGVLFVSAPLNIALSWFLVWNKTYGIGYAGAPIATVINFWVMD
ILLVMYTIFIDGKQCWNGFCSIADLFRKWGQLSHLAIPGIVMLESEYVAYEIMTLFASYF
GTVELAAQSAVGSIASLTYMVPFAVSIAASTRIANFIGGQNIFSAKKATNTSLVFGLVVA
CLNGLVLWSAKGFIAGLFTKDEEVVELIKRLLNPLVSVLQIFDGVASVASGVLRAQGQQK
IGGVINFLSYYAFGLPLALVLCKTLDLKLFGLWIGIGSGMVLISLSETIFILLCDWEAIM
MKAGLMIETDSDSDM

Enzyme Prediction     

No EC number prediction in CXQ87_003106-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	7	372	9e-98	0.9385474860335196

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	1.37e-167	10	362	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
240537	MATE_eukaryotic	5.61e-149	525	957	1	431	Eukaryotic members of the multidrug and toxic compound extrusion (MATE) family. The integral membrane proteins from the MATE family are involved in exporting metabolites across the cell membrane and are responsible for multidrug resistance (MDR) in many bacteria and animals. MATE has also been identified as a large multigene family in plants, where the proteins are linked to disease resistance. A number of family members are involved in the synthesis of peptidoglycan components in bacteria. This subfamily, which is restricted to eukaryotes, contains vertebrate solute transporters responsible for secretion of cationic drugs across the brush border membranes, yeast proteins located in the vacuole membrane, and plant proteins involved in disease resistance and iron homeostatis under osmotic stress.
223608	NorM	3.81e-95	517	963	7	452	Na+-driven multidrug efflux pump [Defense mechanisms].
240536	MATE_NorM_like	1.72e-74	525	945	1	423	Subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins similar to Vibrio cholerae NorM. The integral membrane proteins from the MATE family are involved in exporting metabolites across the cell membrane and are responsible for multidrug resistance (MDR) in many bacteria and animals. This subfamily includes Vibrio cholerae NorM and functions most likely as a multidrug efflux pump, removing xenobiotics from the interior of the cell. The pump utilizes a cation gradient across the membrane to facilitate the export process. NorM appears to bind monovalent cations in an outward-facing conformation and may subsequently cycle through an inward-facing and outward-facing conformation to capture and release its substrate.
273273	matE	1.18e-60	535	872	1	338	putative efflux protein, MATE family. The Multi Antimicrobial Extrusion (MATE) Family (TC 2.A.66) The MATE family consists of probable efflux proteins including a functionally characterized multi drug efflux system from Vibrio parahaemolyticus, a putative ethionine resistance protein of Saccharomyces cerevisiae, and the functionally uncharacterized DNA damage-inducible protein F (DinF) of E. coli. These proteins have 12 probable TMS. [Transport and binding proteins, Other]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWU88511.1|GH76	0.0	1	975	1637	2644
QRG38784.1|GH76	5.59e-248	1	427	3	425
QEO22004.1|GH76	1.59e-247	1	427	3	425
QEL61135.1|GH76	1.59e-247	1	427	3	425
QWW24224.1|GH76	2.67e-247	1	427	17	439

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	1.01e-74	6	391	31	425	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]
5Y50_A	4.32e-47	547	963	32	447	Crystal structure of eukaryotic MATE transporter AtDTX14 [Arabidopsis thaliana]
7DQK_A	4.02e-34	515	952	36	468	Chain A, Protein DETOXIFICATION [Nicotiana tabacum],7DQK_B Chain B, Protein DETOXIFICATION [Nicotiana tabacum]
5XJJ_A	3.50e-33	525	939	13	426	Crystal structure of a MATE family protein [Camelina sativa]
3MKT_A	3.77e-33	524	950	9	444	Structure of a Cation-bound Multidrug and Toxin Compound Extrusion (MATE) transporter [Vibrio cholerae O1 biovar El Tor str. N16961],3MKT_B Structure of a Cation-bound Multidrug and Toxin Compound Extrusion (MATE) transporter [Vibrio cholerae O1 biovar El Tor str. N16961],3MKU_A Structure of a Cation-bound Multidrug and Toxin Compound Extrusion (MATE) transporter [Vibrio cholerae O1 biovar El Tor str. N16961],3MKU_B Structure of a Cation-bound Multidrug and Toxin Compound Extrusion (MATE) transporter [Vibrio cholerae O1 biovar El Tor str. N16961]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ACZ2|DFG5_CANAL	1.48e-169	1	427	22	445	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DFG5 PE=1 SV=1
sp|Q05497|YD338_YEAST	4.68e-155	512	972	215	672	Uncharacterized transporter YDR338C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YDR338C PE=1 SV=1
sp|Q05031|DFG5_YEAST	1.24e-146	1	427	27	452	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1
sp|Q5AD78|DCW1_CANAL	1.71e-128	3	427	21	445	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|Q75DG6|DCW1_ASHGO	4.58e-128	1	420	22	438	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000068	0.000001

TMHMM  Annotations     

Start	End
533	555
562	584
604	626
639	661
676	698
711	730
785	807
834	856
871	893
902	921
931	953