CAZyme Information: CXQ87_003026-t45_1-p1

Basic Information

• Species: [Candida] duobushaemulonis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] duobushaemulonis
• CAZyme ID: CXQ87_003026-t45_1-p1
• CAZy Family: GT91
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1497	PKFP01000003|CGC2	161827.70	5.0430

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CduobushaemulonisB09383	5329	N/A	156	5173

• Gene Location: location=PKFP01000003:316108-321950(-)

Full Sequence      

MHIARQRRHQIEQWNRLIGGEEHHTHTHDDSPMIDTHISPKNKNVSLPSQKWQSFRESVV
IGLERSFTQIGYHCAKFPAITISASILLVILCGSGLSRLTWETEPVKLWVSPNEPALHNK
QYFEDTFGEWYRIEQLFIASSEKEKAVLSWENVQWWFEKELELYTLRDSKNKSISLEEFC
FKPLGDSCAIESFPQYFGGEIGFLNENNWQKQISSCAESPVECLPPFQQPLNKNLLFSSS
EVLESEAFVVTILLESNSSSQDYQLRVTEYEHSLQKWIKGLQAERPDLKISYSTESSLEE
ELNQSTNTDVKIVVISYLVMFLYASLALGGKIPKSLNLKTLIRTRFLLGLSGIIIILLSV
VSAAGVFAYLGVKSTLIIAEVIPFLVLAIGVDNIFLIVHELHCITEKLPEVDVEDRISQA
LGKIGPSCFISAGLQVMMFLLATSVQMPAVRNFAFYSAGAVGINFLLQMSAFISLLSLDQ
RRLESNRVDCIPWVQLDHQVALDQQEFTVDHIEYDFSTYIRKSYAPWLLKPSNKRKILSV
FLVWLGISLCLLPGIELGLDQKIALPSSSYLVDYFESVYKYLNVGPPVFFVVKDLDVTNR
EEQQALCGKFSTCNEFSLANILEQEFKRSEVSTIAEPASNWLDDFLNWLNPALDQCCRFK
NTMEGLPQGKEFMKFFRQWITEPSDPCPLGGKATYSNSLKYNSSKVEASYFRTSHTPMRS
QKDFIVGFKNSIRIVNEVKKYIGARSTGPNEVIVTGTFDNWSKSYSLVKQADGSFELNVP
LDRSSEVLYKYVVDGDWTTSKDQKTTSDSSGHTNNVLEPVKAKDYKGTTSRIPEAGGIGA
AVAQGSSATASSHAGDKDLKTTVLPSSEGKQTTLGEPGIFVPQAKDTEALAAFENVRNVD
PKTLNEPKDDEKFTKELTPEEKKKQKKKLKKTQYKLRKKQQKQAAGGAAVGAAGGAAAGG
AAAGGAAAGSAGSKATTGEDNDQDNDQSEDSEYEKSPEPEAVEATVTGTILGAVGGAATA
GAGGALVGALGGASAGQAAHNYSSSHSEDASTTTKTEETEAPQTLDPGRQALNIPGSIAG
VDKVPTRDDDNLATKTKTLDTLTSSEYVDSKDEDAPDSSNAAVGGAAVGGAAVGAIPEDK
KAEATTQDGLSKQNENTEEYPVKGDLTQAGAAAVPVTAVYEDKKSAQNGADKPSTEDALK
KQKENTESYPAKDDLTTAGAAAVPVAAVYADKKTDGGASQVEPLDSDKLAKSIEDKTDFP
EDPQAKEAEDKDKKHDAAVVGAGAAAGVAAGAVGGTAASRGAGAAPAKETTEPAVPVQPV
SQEKAAPVSKAAEPKVDAPVASKDGSEVPGVFGSGSAVTPEVGPKEVSAKEVDAAPVTRS
NDHRYDSEDEIIIAQGGESVKQVEKRIQEWEGDVSVEQIQPSPSEARRLAEEAHLSKQAQ
LAAERGQEVASPSNPPAGPVKADKKSPKKAEKAPNAAQQHATKTKKGILSKLKKIFK

Enzyme Prediction     

No EC number prediction in CXQ87_003026-t45_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273337	2A060601	4.14e-149	39	725	286	1010	Niemann-Pick C type protein family. The model describes Niemann-Pick C type protein in eukaryotes. The defective protein has been associated with Niemann-Pick disease which is described in humans as autosomal recessive lipidosis. It is characterized by the lysosomal accumulation of unestrified cholesterol. It is an integral membrane protein, which indicates that this protein is most likely involved in cholesterol transport or acts as some component of cholesterol homeostasis. [Transport and binding proteins, Other]
403533	Sterol-sensing	2.74e-60	341	496	1	153	Sterol-sensing domain of SREBP cleavage-activation. Sterol regulatory element-binding proteins (SREBPs) are membrane-bound transcription factors that promote lipid synthesis in animal cells. They are embedded in the membranes of the endoplasmic reticulum (ER) in a helical hairpin orientation and are released from the ER by a two-step proteolytic process. Proteolysis begins when the SREBPs are cleaved at Site-1, which is located at a leucine residue in the middle of the hydrophobic loop in the lumen of the ER. Upon proteolytic processing SREBP can activate the expression of genes involved in cholesterol biosynthesis and uptake. SCAP stimulates cleavage of SREBPs via fusion of the their two C-termini. This domain is the transmembrane region that traverses the membrane eight times and is the sterol-sensing domain of the cleavage protein. WD40 domains are found towards the C-terminus.
308203	Patched	5.28e-37	241	679	150	571	Patched family. The transmembrane protein Patched is a receptor for the morphogene Sonic Hedgehog. This protein associates with the smoothened protein to transduce hedgehog signals.
273338	2A060602	1.86e-25	238	489	310	567	The Eukaryotic (Putative) Sterol Transporter (EST) Family.
199889	E_set_AMPKbeta_like_N	7.00e-23	745	818	7	79	N-terminal Early set domain, a glycogen binding domain, associated with the catalytic domain of AMP-activated protein kinase beta subunit. E or "early" set domains are associated with the catalytic domain of AMP-activated protein kinase beta subunit glycogen binding domain at the N-terminal end. AMPK is a metabolic stress sensing protein that senses AMP/ATP and has recently been found to act as a glycogen sensor as well. The protein functions as an alpha-beta-gamma heterotrimer. This N-terminal domain is the glycogen binding domain of the beta subunit. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and isoamylase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWW24293.1|CBM48	0.0	3	1497	279	1913
QEL61054.1|CBM48	1.79e-130	747	1497	10	685
QEO21921.1|CBM48	3.45e-130	747	1497	10	685
QRG38704.1|CBM48	6.64e-130	747	1497	10	685
SGZ56659.1|CBM48	2.21e-47	744	909	31	197

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6R4L_A	1.25e-163	63	734	323	972	Crystal structure of S. cerevisia Niemann-Pick type C protein NCR1 [Saccharomyces cerevisiae S288C]
3JD8_A	2.35e-97	63	743	335	1070	cryo-EM structure of the full-length human NPC1 at 4.4 angstrom [Homo sapiens],5JNX_A The 6.6 A cryo-EM structure of the full-length human NPC1 in complex with the cleaved glycoprotein of Ebola virus [Homo sapiens]
6UOX_A	2.58e-97	63	743	335	1070	Structure of itraconazole-bound NPC1 [Homo sapiens]
5U73_A	3.17e-97	63	743	335	1070	Crystal structure of human Niemann-Pick C1 protein [Homo sapiens],5U74_A Structure of human Niemann-Pick C1 protein [Homo sapiens]
6W5R_A	3.40e-97	63	743	335	1070	NPC1 structure in Nanodisc [Homo sapiens],6W5S_A NPC1 structure in GDN micelles at pH 8.0 [Homo sapiens],6W5T_A NPC1 structure in GDN micelles at pH 5.5, conformation a [Homo sapiens],6W5U_A NPC1 structure in GDN micelles at pH 5.5, conformation b [Homo sapiens],6W5V_A NPC1-NPC2 complex structure at pH 5.5 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12200|NPC1_YEAST	3.28e-163	63	734	323	972	NPC intracellular sterol transporter 1-related protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NCR1 PE=1 SV=1
sp|P56941|NPC1_PIG	3.92e-99	62	747	334	1073	NPC intracellular cholesterol transporter 1 OS=Sus scrofa OX=9823 GN=NPC1 PE=2 SV=1
sp|O15118|NPC1_HUMAN	1.21e-96	63	743	335	1070	NPC intracellular cholesterol transporter 1 OS=Homo sapiens OX=9606 GN=NPC1 PE=1 SV=2
sp|O35604|NPC1_MOUSE	1.16e-93	63	747	335	1073	NPC intracellular cholesterol transporter 1 OS=Mus musculus OX=10090 GN=Npc1 PE=1 SV=2
sp|Q6T3U4|NPCL1_MOUSE	1.29e-91	39	777	309	1117	NPC1-like intracellular cholesterol transporter 1 OS=Mus musculus OX=10090 GN=Npc1l1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000040	0.000008

TMHMM  Annotations     

Start	End
312	329
350	372
376	398
424	446
456	478
537	559