CAZyme Information: CXQ87_002202-t45_1-p1

Basic Information

• Species: [Candida] duobushaemulonis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] duobushaemulonis
• CAZyme ID: CXQ87_002202-t45_1-p1
• CAZy Family: GH63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
436	PKFP01000001|CGC2	50672.25	9.3476

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CduobushaemulonisB09383	5329	N/A	156	5173

• Gene Location: location=PKFP01000001:1674325-1675635(+)

Full Sequence      

MLTLRLRPKSKASQSSPFLPEPATFKSIRPRTNKFGILLLVAIVFWFFNPFRWVTYPFAP
PAPRYPAAYPYTSEHVIETPSKYIYPVVEDVPKLKELGAKNLVRQVRVQDAEVPELQKTL
LQSLNVLDDKDPVVQKQKEEAENAKSEEARVKNAFKNHDKKVFKPKSLKNYPKAVIVTAI
DFDRYSVDAITKIIQNRVDYGYAQNYGVYVRWVQEFVPLMNSLNFLTDKERSKWVRIYCL
RAAMFAFPHAEWFWYFDQDGLVMNQKVDLIEYLVDTESLRKSMLLEQPVIPPDGLIKTYK
NVQPNRVRLIFTQSDRKIESNSFIVKNDFLGKGLLDTWGDRLFLNYNNFPYGPESAITHF
LQWHPFVLSRTVIVPARTINSLHSESALDDKAQDQMHYYSGDLVAQWSSCETPLKCEEVL
NGYHALLKKDETQPKN

Enzyme Prediction     

No EC number prediction in CXQ87_002202-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	172	417	1.1e-65	0.983739837398374

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	1.22e-48	172	416	3	238	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
215616	PLN03181	5.08e-04	189	261	149	210	glycosyltransferase; Provisional
215617	PLN03182	0.002	192	261	151	209	xyloglucan 6-xylosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWU87725.1|GT34	6.33e-266	68	436	328	696
QWW23700.1|GT34	7.13e-239	1	430	1	431
QEO20536.1|GT34	7.13e-239	1	430	1	431
QEL60804.1|GT34	1.44e-238	1	430	1	431
QRG37634.1|GT34	2.04e-238	1	430	1	431

PDB Hits     

CXQ87_002202-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P46985|MNN11_YEAST	3.74e-55	4	429	1	421	Probable alpha-1,6-mannosyltransferase MNN11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN11 PE=1 SV=2
sp|O13640|YGWH_SCHPO	7.01e-23	153	424	44	307	Uncharacterized alpha-1,2-galactosyltransferase C8D2.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi048 PE=3 SV=2
sp|O94622|YBKD_SCHPO	3.38e-22	190	427	124	350	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|Q09174|GMA12_SCHPO	1.24e-18	234	427	161	350	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|Q09679|GMH1_SCHPO	1.14e-17	195	423	110	324	Probable alpha-1,2-galactosyltransferase gmh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999994	0.000028

TMHMM  Annotations     

Start	End
35	54