CAZyme Information: CXQ87_001837-t45_1-p1

Basic Information

• Species: [Candida] duobushaemulonis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] duobushaemulonis
• CAZyme ID: CXQ87_001837-t45_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1035		116407.46	5.6327

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CduobushaemulonisB09383	5329	N/A	156	5173

• Gene Location: location=PKFP01000001:791961-795364(-)

Full Sequence      

MYTEEQRKKIDGLVAQWLAVDPMSCHQKYKELDGKLGKRIAFGTAGLRSSMESGFAHMND
VTILQASQGLVSYLSKTENPSLVVGYDHRFHSQRYAEITASVALASGFTVYYLGTAESLS
DESDPETREGDKAYVHTPMVPFGIDFYKASAGVMVTASHNPAKDNGYKVYYGNGCQIIPP
HDAGIAKSIDENLEPWKDRGVWDVKGNFEKGLKEGKLVLVKEELSAKYVEAATEQLIRKS
SLSYKFVYTPMHGVGLEMFSRIFKKFHAKQTDVDVVPEQAFPDPKFPSVPFPNPEEKGAL
DLAIARAEAQGLSLVVANDPDADRFSVAIKRKNGKWQQLTGNEIGILFAAYVVEERTSKA
DLSETWLLNSTVSSQLLRSLAEKTGCHFQDTLTGFKWIGNKAIDLKKAGKLVPFGYEEAI
GYMFSVVNDKDGISAAVMWLQLYEEWFGDGKQDPIEKLESIYQKYGWFKECNGYYKLDTS
KTPGIFQAIRDSFPGDAPSTLGDFNVTEWRDLTIGYESSTPDHVPILPVDPSSQMITAVL
QPPHSSEQVRFTCRGSGTEPKLKVYIEGRSNGSEEAASKLARACWDTLKKHWFKPEENGL
QEVTTLEGMLRGLLIGAVALLLVWTFFQRNNGFNPSIQEKAVLTEDYDLYKVTKDGVHKV
EPEDASTTEEAEQIYKDTVHIHDLNDYQGTTAGEAHNEVHVLPMAFQNIMNLTYDHSLID
IAFLVSDCSPGDTTLESVFKYSISLQNGTLADELLAAEQNKRNNLVRGTNDLYENYMDQG
YMENVRKAYNSPETWHKGYRTPFRSVSIYVKDFGQVIGQGFSDRHAVKVQGIRRKLMGRA
RNWLTASALRAHHSWVYWRDVDIETCPGSVIQDLMKFDYDVMVPNIWRPLPGFLGNEQPY
DLNSWVESEPALELAKKLDEDDVIVEGYAEYPTWRVHLAYLRDANGNPNEVLDLDGVGGV
SILAKAKIFRQGVHFPAFTFLNHAETEAFGKMAKQMGFRVGGLPHYTIWHIYEPSEDDLK
KIAAMEREKRRKQST

Enzyme Prediction     

No EC number prediction in CXQ87_001837-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	697	979	2.3e-110	0.8731343283582089

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
240294	PTZ00150	0.0	9	604	4	582	phosphoglucomutase-2-like protein; Provisional
100092	PGM2	0.0	39	590	1	487	This CD includes PGM2 (phosphoglucomutase 2) and PGM2L1 (phosphoglucomutase 2-like 1). The mammalian PGM2 is thought to be a phosphopentomutase that catalyzes the conversion of the nucleoside breakdown products, ribose-1-phosphate and deoxyribose-1-phosphate to the corresponding 5-phosphopentoses. PGM2L1 is thought to catalyze the 1,3-bisphosphoglycerate-dependent synthesis of glucose 1,6-bisphosphate and other aldose-bisphosphates that serve as cofactors for several sugar phosphomutases and possibly also as regulators of glycolytic enzymes. PGM2 and PGM2L1 belong to the alpha-D-phosphohexomutase superfamily which includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Other members of this superfamily include phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, the bacterial phosphoglucosamine mutase GlmM, and the bifunctional phosphomannomutase/phosphoglucomutase (PMM/PGM). Each of these enzymes has four domains with a centrally located active site formed by four loops, one from each domain. All four domains are included in this alignment model.
397491	Anp1	4.02e-140	678	979	1	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.
224034	ManB	6.35e-86	34	582	2	451	Phosphomannomutase [Carbohydrate transport and metabolism].
100093	PGM_like2	3.06e-51	40	570	1	446	This PGM-like (phosphoglucomutase-like) protein of unknown function belongs to the alpha-D-phosphohexomutase superfamily and is found in both archaea and bacteria. The alpha-D-phosphohexomutases include several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Other members of this superfamily include phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, the bacterial phosphoglucosamine mutase GlmM, and the bifunctional phosphomannomutase/phosphoglucomutase (PMM/PGM). Each of these enzymes has four structural domains (subdomains) with a centrally located active site formed by four loops, one from each subdomain. All four subdomains are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWW21720.1|GT62	0.0	2	1031	7	1028
QOU21558.1|GT62	0.0	6	1031	3	1123
QWU88049.1|GT62	8.88e-304	617	1035	17	446
QRG37029.1|GT62	2.13e-276	607	1031	24	459
QEL58498.1|GT62	1.72e-275	607	1031	24	459

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	7.46e-46	682	1013	9	302	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]
1TUO_A	6.75e-12	40	570	12	447	Crystal structure of putative phosphomannomutase from Thermus Thermophilus HB8 [Thermus thermophilus]
2Z0F_A	8.87e-10	40	567	24	500	Crystal structure of putative phosphoglucomutase from Thermus thermophilus HB8 [Thermus thermophilus HB8],2Z0F_B Crystal structure of putative phosphoglucomutase from Thermus thermophilus HB8 [Thermus thermophilus HB8]
1WQA_A	2.30e-09	42	463	5	372	Crystal Structure of Pyrococcus horikoshii phosphomannomutase/phosphoglucomutase complexed with Mg2+ [Pyrococcus horikoshii],1WQA_B Crystal Structure of Pyrococcus horikoshii phosphomannomutase/phosphoglucomutase complexed with Mg2+ [Pyrococcus horikoshii],1WQA_C Crystal Structure of Pyrococcus horikoshii phosphomannomutase/phosphoglucomutase complexed with Mg2+ [Pyrococcus horikoshii],1WQA_D Crystal Structure of Pyrococcus horikoshii phosphomannomutase/phosphoglucomutase complexed with Mg2+ [Pyrococcus horikoshii]
5VG7_B	1.02e-07	43	466	20	423	Crystal Structure of the R503Q missense variant of human PGM1 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00314|VAN1_CANAX	7.77e-206	638	1034	27	442	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|Q03262|PGM3_YEAST	1.60e-187	29	597	42	615	Phosphoribomutase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRM15 PE=1 SV=1
sp|P23642|VAN1_YEAST	2.52e-171	650	1031	142	532	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|O74478|PGM3_SCHPO	1.24e-131	27	602	32	586	Probable phosphoribomutase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1840.05c PE=1 SV=1
sp|Q96G03|PGM2_HUMAN	8.13e-116	9	601	14	608	Phosphopentomutase OS=Homo sapiens OX=9606 GN=PGM2 PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CXQ87_001837-t45_1-p1.