CAZyme Information: CXQ87_000400-t45_1-p1

Basic Information

• Species: [Candida] duobushaemulonis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] duobushaemulonis
• CAZyme ID: CXQ87_000400-t45_1-p1
• CAZy Family: CBM67|GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
505	PKFP01000008|CGC5	56958.75	7.8417

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CduobushaemulonisB09383	5329	N/A	156	5173

• Gene Location: location=PKFP01000008:873615-875132(-)

Full Sequence      

MGLSKLVDKMRNHSVASVNAADPPVDAGKAPSKKQIYRARYNFGPNFGAVFVGEKWIFHS
IFPKGAETELQAAEGNIKELGVDGARKKYEKHWKSYVNDDDWAWLHDNGVTAIRLPIGYW
NIDGGKYTKGTKFEKVAGVYKNSWDIIKKNFIEPAGRFHIGVLIDIHGLPYGANGNDHSG
ETNNGKAEFWSKSSAQSLMIDALKFLAGDIARYENVAGIQIVNEAEFSDSATKQKKYYAD
AINAIRSVDKSVPVVISDGWWPDQWAKWVQENQDIGTTIGVVVDHHVYRCFDGKDKNKDP
NRITKDLEGDLLTNLTEDGSGVDFMVGEWSCVLDGQSFSKAGLDPNDYGNSKRAEFASKY
GAKVADLIFKRAGAGCYFWTYKFESGNGGEWDFRQQLHKAFSPPKISVPDENKFKELLKN
NFKAHSDYWNSQNSKEKYEHDRYKEGFTVAWNDNLAFAKQGSLLGRRQALKSARLKEHID
AKGKSKFLWEWEQGYDKGCEEFNNL

Enzyme Prediction     

No EC number prediction in CXQ87_000400-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	88	389	4e-121	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	6.27e-29	29	393	5	327	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWU86148.1|GH5_49	0.0	1	505	1	505
QEL59437.1|GH5_49	0.0	1	505	1	505
QEO19646.1|GH5_49	0.0	1	505	1	505
QWW22528.1|GH5_49	0.0	1	505	1	505
QRG36096.1|GH5_49	0.0	1	505	1	505

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	3.52e-18	44	407	11	383	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	4.72e-18	44	407	11	383	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	4.95e-18	44	407	17	389	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
3N9K_A	8.82e-18	44	407	16	388	F229A/E292S Double Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]
3O6A_A	8.82e-18	44	407	16	388	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38081|YBQ6_YEAST	1.55e-105	23	503	27	499	Uncharacterized glycosyl hydrolase YBR056W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YBR056W PE=1 SV=1
sp|O74799|EXG3_SCHPO	1.45e-92	32	494	4	444	Glucan 1,3-beta-glucosidase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=exg3 PE=3 SV=1
sp|Q7Z9L3|EXGA_ASPOR	1.49e-24	44	414	33	401	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
sp|B8N151|EXGA_ASPFN	1.49e-24	44	414	33	401	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
sp|Q4WK60|EXGA_ASPFU	1.16e-22	27	407	20	407	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CXQ87_000400-t45_1-p1.