CAZyme Information: CXQ87_000338-t45_1-p1

Basic Information

• Species: [Candida] duobushaemulonis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] duobushaemulonis
• CAZyme ID: CXQ87_000338-t45_1-p1
• CAZy Family: AA6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
462	PKFP01000008|CGC17	50387.24	4.6533

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CduobushaemulonisB09383	5329	N/A	156	5173

• Gene Location: location=PKFP01000008:729590-730978(+)

Full Sequence      

MKAYFALCLAFFASFAAAADWNPTYCNETTKCPEDLPCCSQFGMCGTGSYCLGGCDIRRS
YNMSACMPMPRMESFEESFKNIDHIEKQSEYLGNYTEADWVYTGHIANHGNSLLLQMPNQ
STGAVVSSTRYLWYGKVGATIKSSRDKGVVTAFITFSDVQDEIDFEWLGYELDKVESNYY
YQGVLNYTNQKMHDISDTFENWHYYEIDWKEDELHWSIDGEVIRTLTRSETWNETRKAYM
YPQTPSRVQFSLWPGGGADNAEGTIEWAGGAIDWDSKDIKKNGYYYAYVKNVTVETYDLP
SFAKKNVSNSTKGYHAYLYNSTDANEKNIFLTKDKTWLGSGDATGFDPDNEEKVETTTSG
SKTITKTSSKSKTGTVDVPTGNGNGGAAGNRGGSGTTSTSEYTGGFVQNSNGSGTSGSSG
SSGSGSGSGSGSGSSSGAPSYTVERILALAAGVVGAVFTFAI

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	102	273	4e-79	0.9885057471264368

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185692	GH16_fungal_CRH1_transglycosylase	4.29e-91	90	298	2	203	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	6.05e-54	103	269	3	168	Glycosyl hydrolases family 16.
211314	ChtBD1_GH16	1.44e-25	24	70	1	47	Hevein or Type 1 chitin binding domain subfamily that co-occurs with family 16 glycosyl hydrolases. This subfamily includes Saccharomyces cerevisiae Utr2p, also known as Crh2p, which participates in the cross-linking of chitin to beta(1-3)- and beta(1-6) glucan in the cell wall, and S. cerevisiae Crr1p, a putative transglycosidase which is needed for proper spore wall assembly. ChtBD1 is a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
225182	BglS	8.29e-21	70	276	42	259	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185684	GH16_lichenase	7.76e-20	122	269	56	193	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWU86090.1|CBM18|GH16_19	2.44e-269	1	462	2439	2900
QWW22589.1|CBM18|GH16_19	1.53e-231	1	461	1	453
QEL59501.1|CBM18|GH16_19	8.81e-231	1	461	1	453
QEO19583.1|CBM18|GH16_19	8.81e-231	1	461	1	453
QRG36032.1|CBM18|GH16_19	1.25e-230	1	461	1	453

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IBU_A	8.14e-32	89	295	20	222	Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBU_B Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBW_A Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293],6IBW_B Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293]
3D6E_A	1.48e-16	112	269	37	181	Crystal structure of the engineered 1,3-1,4-beta-glucanase protein from Bacillus licheniformis [Bacillus licheniformis],3D6E_B Crystal structure of the engineered 1,3-1,4-beta-glucanase protein from Bacillus licheniformis [Bacillus licheniformis]
1GBG_A	8.92e-16	134	269	72	194	Bacillus Licheniformis Beta-Glucanase [Bacillus licheniformis]
3O5S_A	2.11e-14	134	269	96	218	Crystal Structure of the endo-beta-1,3-1,4 glucanase from Bacillus subtilis (strain 168) [Bacillus subtilis]
3WVJ_A	3.89e-14	131	269	71	196	Chain A, Beta-glucanase [Acetivibrio thermocellus ATCC 27405],3WVJ_B Chain B, Beta-glucanase [Acetivibrio thermocellus ATCC 27405]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AJC0|UTR2_CANAL	8.21e-163	4	353	7	360	Extracellular glycosidase UTR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UTR2 PE=1 SV=1
sp|Q4WI46|CRF2_ASPFU	1.46e-114	7	349	8	347	Probable glycosidase crf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf2 PE=1 SV=1
sp|P32623|CRH2_YEAST	9.88e-113	7	359	9	355	Probable glycosidase CRH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UTR2 PE=1 SV=3
sp|Q75A41|CRR1_ASHGO	1.34e-71	26	298	31	363	Probable glycosidase CRR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=CRR1 PE=3 SV=1
sp|Q05790|CRR1_YEAST	6.24e-68	22	315	27	388	Probable glycosidase CRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRR1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000190	0.999777	CS pos: 18-19. Pr: 0.9765

TMHMM  Annotations     

There is no transmembrane helices in CXQ87_000338-t45_1-p1.