CAZyme Information: CXQ85_005269-t46_1-p1

Basic Information

• Species: [Candida] haemuloni
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] haemuloni
• CAZyme ID: CXQ85_005269-t46_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
425	PKFO01000008|CGC2	49181.76	4.5629

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ChaemulonisB11899	5409	N/A	160	5249

• Gene Location: location=PKFO01000008:846413-847690(+)

Full Sequence      

MRLFSVFSLFTQTLALSIVNRDGKGSAWDYENKKIHGVNLGGWFLLEPYITPSLFKAFEP
EEIPVDDYHYHKTLGKEEAKRRLEHHWDTWYTEEEFKKMADAGINTVRIPIGYWAYGLLP
DDPYVQGQDFYLERALGWARKYGIVAWIDLHGAPGSQNGGTSSGLRGSFNSLEELHESIG
YQSDENISLTLTVLQKIFNKYGAPEFEDVVSGIGFLNEPLGLASNMDLLKDFYKWAYGNM
RSVSSNNVIISDAFIEEDGYWDDFMTVDQGYWKVVLDHHHYQWHTPEELNMNVDEHVRTA
CNFGIKHTREYHWNVIGEWSAAMTDCTPWLNGVGRGARYTGDYQNSPPFGSCEPYQSLEN
WTEEYKKDVRKFIEGQMDAYSTASGWIFWNWKCEDAAEWDMSKLIELGLFPQPFDDRQYP
DQCGY

Enzyme Prediction     

EC	3.2.1.58:29	3.2.1.21:6	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	85	394	9.9e-113	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	3.98e-70	34	424	17	395	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	7.19e-07	86	250	15	164	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWW24991.1|GH5_9	2.98e-262	1	425	1	428
QEO23771.1|GH5_9	1.72e-261	1	425	1	428
QWU88288.1|GH5_9	1.94e-259	4	424	3	421
QRG39874.1|GH5_9	6.68e-259	1	425	1	428
QWU88320.1|GH5_9	1.54e-243	1	425	1	428

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3O6A_A	1.05e-171	23	425	2	398	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PB1_A	3.11e-171	23	425	3	399	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
1EQP_A	3.57e-171	27	425	1	393	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
2PF0_A	6.26e-171	23	425	3	399	Chain A, Hypothetical protein XOG1 [Candida albicans]
1CZ1_A	7.18e-171	27	425	1	393	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12700|EXG_SCHOC	2.44e-178	24	425	31	425	Glucan 1,3-beta-glucosidase OS=Schwanniomyces occidentalis OX=27300 PE=3 SV=1
sp|Q8NKF9|EXG_CANOL	8.23e-172	6	425	8	425	Glucan 1,3-beta-glucosidase OS=Candida oleophila OX=45573 GN=EXG1 PE=3 SV=1
sp|P29717|EXG1_CANAL	3.01e-170	23	425	41	437	Glucan 1,3-beta-glucosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=XOG1 PE=1 SV=5
sp|O93983|EXG2_WICAO	8.98e-167	4	423	6	426	Glucan 1,3-beta-glucosidase 2 OS=Wickerhamomyces anomalus OX=4927 GN=EXG2 PE=3 SV=1
sp|Q12725|EXG_YARLI	6.99e-155	16	425	18	421	Glucan 1,3-beta-glucosidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=EXG1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.568595	0.431405

TMHMM  Annotations     

There is no transmembrane helices in CXQ85_005269-t46_1-p1.