CAZyme Information: CXQ85_005140-t46_1-p1

Basic Information

• Species: [Candida] haemuloni
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] haemuloni
• CAZyme ID: CXQ85_005140-t46_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360		40540.19	5.3318

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ChaemulonisB11899	5409	N/A	160	5249

• Gene Location: location=PKFO01000008:513921-515003(-)

Full Sequence      

MTTIAIRTTTNSRSRLFSVLAGAATLVAGSAGATYFYENSIRGSNRNNDDKPPGRGNSLK
FFAAATPAQMAKVFNDKTEKDFQEVYNAIAQKVQDEDDADDGAGRYGLLCRLAWHSSGTY
DKKKNTGGSYSGSMIYAPESVDPENAGLDSGRDFLNEFHYQFPWISRGDLWTLGGVVAVQ
EAGGPKIRWRPGRVDCTKAEKEKIPENGNLPDASQESGAYVRKIFNRLGFDDREMVALIG
AHALGKCHTYRSGYDGPWGPSPNMFTNDFFVRLLQKWHIRDWDGKRQYQDDETESFMMLP
TDMVLKEDSKFLKYVKLYAGDQDLFFADFSKAFTRLLENGIEFAKETPYYEFKTLEEQSE

Enzyme Prediction     

No EC number prediction in CXQ85_005140-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	88	340	2.4e-48	0.9647058823529412

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173825	ascorbate_peroxidase	3.56e-121	70	344	1	253	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
178218	PLN02608	3.73e-60	108	340	33	243	L-ascorbate peroxidase
223453	KatG	1.40e-57	7	358	1	435	Catalase (peroxidase I) [Inorganic ion transport and metabolism].
173823	plant_peroxidase_like	1.58e-49	107	338	19	255	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
178467	PLN02879	1.60e-49	108	340	36	246	L-ascorbate peroxidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWW25871.1|AA2	1.96e-230	1	358	1	355
QEO24004.1|AA2	1.96e-230	1	358	1	355
QRG40856.1|AA2	1.61e-229	1	358	1	355
QWU90274.1|AA2	1.05e-200	11	358	1291	1634
QFZ35043.1|AA2	5.26e-153	15	360	48	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2V2E_A	1.59e-101	66	358	3	292	Structure of isoniazid (INH) bound to cytochrome c peroxidase mutant N184R Y36A [Saccharomyces cerevisiae]
2V23_A	3.42e-101	70	358	9	294	Structure of cytochrome c peroxidase mutant N184R Y36A [Saccharomyces cerevisiae],4A6Z_A Cytochrome c peroxidase with bound guaiacol [Saccharomyces cerevisiae]
4A71_A	4.85e-101	70	358	9	294	cytochrome c peroxidase in complex with phenol [Saccharomyces cerevisiae]
3M23_A	1.17e-100	70	358	4	289	Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M25_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M26_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M27_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M28_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M29_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2A_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2B_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2C_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2D_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2E_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2F_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2G_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2H_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2I_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae]
5EJT_A	1.29e-100	70	358	7	292	Thermally annealed ferryl Cytochrome C Peroxidase crystal structure [Saccharomyces cerevisiae S288C],5EJX_A X-ray Free Electron Laser Structure of Cytochrome C Peroxidase [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6BKY9|CCPR_DEBHA	2.59e-145	24	358	35	358	Cytochrome c peroxidase, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=CCP1 PE=3 SV=1
sp|Q5AEN1|CCPR_CANAL	1.43e-136	27	360	30	365	Cytochrome c peroxidase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CCP1 PE=3 SV=2
sp|Q6C0Z6|CCPR_YARLI	6.20e-104	54	353	31	336	Cytochrome c peroxidase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=CCP1 PE=3 SV=1
sp|Q6FMG7|CCPR_CANGA	2.58e-99	76	358	77	355	Cytochrome c peroxidase, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=CAGL0K08184g PE=3 SV=1
sp|P00431|CCPR_YEAST	5.87e-99	63	358	66	359	Cytochrome c peroxidase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CCP1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.608092	0.391911

TMHMM  Annotations     

Start	End
16	38