CAZyme Information: CXQ85_005133-t46_1-p1

Basic Information

• Species: [Candida] haemuloni
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] haemuloni
• CAZyme ID: CXQ85_005133-t46_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391	PKFO01000008|CGC3	44688.31	9.3690

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ChaemulonisB11899	5409	N/A	160	5249

• Gene Location: location=PKFO01000008:503710-504885(-)

Full Sequence      

MTNRRRLAVAALALFVVIIVVTKFSVSRSKNLRLSNIDNLAGMSSLISNENSKKQDEFFK
KLEKMQSQLYSKHEERLKNLEKQNEFLIEQIKLMRSPPEKFSLREKLAFMTPYDPKTKFP
AYVWQTWKHGLNDDRFDAQYREGQAQWAVKNPGFVHELFNDDTTFATVKHLYQHAPEVVE
AYKSMPEVILKMDFFKYLILFAKGGVYADVDTVPLQPVPNWIPENVSPTELGLIIAVGSD
SNSADWRSDTVRRLEFGNFVIQCKPGHPIFREIIASITENTLGLRRTLKEGEQLALEGSS
NQKSLAISKWTGSGLWTDTILEYLNDYVKSSIYQSVSWKDFHALEKPKLVSDVLVLPIKS
FASTLEVPKDGKISDPIAFVKHYSANIWKSG

Enzyme Prediction     

No EC number prediction in CXQ85_005133-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	141	224	2.5e-19	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	3.92e-41	71	385	34	343	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.07e-17	147	228	11	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWU90279.1|GT32	3.90e-265	1	391	1	391
QRG40850.1|GT32	8.97e-255	1	391	1	391
QEL63264.1|GT32	1.81e-254	1	391	1	391
QEO24011.1|GT32	5.18e-254	1	391	1	391
QWW25867.1|GT32	2.99e-253	1	391	1	391

PDB Hits     

CXQ85_005133-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P47124|HOC1_YEAST	2.87e-97	63	390	74	389	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q5A4E3|OCH1_CANAL	1.52e-69	96	389	76	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	3.39e-52	87	389	64	470	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q9UTR6|OCH1_SCHPO	4.03e-52	104	389	129	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.957209	0.042811

TMHMM  Annotations     

Start	End
7	26