CAZyme Information: CXQ85_004854-t46_1-p1

Basic Information

• Species: [Candida] haemuloni
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] haemuloni
• CAZyme ID: CXQ85_004854-t46_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370	PKFO01000006|CGC1	38987.14	5.7705

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ChaemulonisB11899	5409	N/A	160	5249

• Gene Location: location=PKFO01000006:744309-745421(+)

Full Sequence      

MLFKSFVQAAIVASAIAQPIQHQHHQHEKKAVVVTNWNTVFVTQTAGAPQQEESQPTAEA
QPDNEAHAAGVIGDLIGGGDSSSSASSTASTPSKPAPSSSGSDSVSIPSSTGSFSGPAKA
ITYSPYSDDGGCKSASQIKKEVSKLSGFETIRLYGVDCNQVEAALSGFAPGQKLFAGIFD
VHQIEKDVETLSKAVKNHGGWDVVSTVSIGNELVNAGQATPSQIGKYVESGRSALKSQGY
SGPVVSVDTFIAVINNPDLCKHSDYMAVNAHAFFDGHIAAKDAGDWVLLQLQRVSNACGD
SKKVFITETGWPTKGDSNKVAIPSSENQKSALQSISDKCGDSVTYFNAYNDMWKNPGPFN
AEQFWGVYTA

Enzyme Prediction     

No EC number prediction in CXQ85_004854-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	130	369	2e-23	0.9292604501607717

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	3.68e-90	107	370	33	303	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	0.001	259	369	164	298	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWU89642.1|GH17	5.98e-200	1	370	1	366
QEO21484.1|GH17	2.10e-164	107	370	100	363
QRG37253.1|GH17	2.10e-164	107	370	100	363
QWW21518.1|GH17	2.10e-164	107	370	100	363
QEL58275.1|GH17	2.10e-164	107	370	100	363

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	2.28e-09	128	354	45	272	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59XX2|MP65_CANAL	1.34e-122	1	369	1	377	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|Q04951|SCW10_YEAST	2.63e-104	118	370	136	388	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|P53334|SCW4_YEAST	3.10e-102	113	369	128	384	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|P53189|SCW11_YEAST	4.52e-51	119	367	282	537	Probable family 17 glucosidase SCW11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW11 PE=1 SV=1
sp|Q0CEX9|BTGE_ASPTN	1.59e-45	97	366	284	553	Probable beta-glucosidase btgE OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=btgE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000543	0.999455	CS pos: 17-18. Pr: 0.9606

TMHMM  Annotations     

There is no transmembrane helices in CXQ85_004854-t46_1-p1.