CAZyme Information: CXQ85_004285-t46_1-p1

Basic Information

• Species: [Candida] haemuloni
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] haemuloni
• CAZyme ID: CXQ85_004285-t46_1-p1
• CAZy Family: GT59
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
498		57091.36	7.8855

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ChaemulonisB11899	5409	N/A	160	5249

• Gene Location: location=PKFO01000004:370030-371526(+)

Full Sequence      

MHPTLKIFGVVAVLRFLNAISIITFFQPDEFYQALEPAHKLVYGYGYITWEWHEGLRSSL
HPWLYALAYKAVGAVVSEDWAVYLAPRLMGAAVAAVGETYLYKFALKYTGSVQVATFALA
ASVLSGWNWFFITRAFSNNLEMVLTTVGLAYWPWNRPNGCIVKSCIFGFLSCIVRPTNAL
LWGFLGAGYVVKNLSQPLQLASLGLDLGVLFGVICALTALPDLFFYGKFTVPLYNFLEFN
VVKNLSIFYGSAPWHFYLFQGIPLLLMGYLPLWAMSMWRYRNTLLVNTTLFVIIGFSCIA
HKEFRFIYPLYPIFMVHTAQAARTLFHRKYFKALAVSVVLLHSMVAFFFTRINESGEIGV
VNWLTTISNVSSVGFLTPCHSVPWHSSFHREDLVSNLWMLTCEPPLHLANGNLENVRSYR
DESDRFFDNPEQFLKDTIGTPQRPWPSHLVIFQHMEDVVSTFLQDTSYKECARFFNSYFH
WDPRRWGDIIVYCQNESL

Enzyme Prediction     

No EC number prediction in CXQ85_004285-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	9	389	1.3e-94	0.9922879177377892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215437	PLN02816	1.48e-71	6	497	40	546	mannosyltransferase
281842	Glyco_transf_22	7.91e-63	7	389	2	414	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWU87001.1|GT22	1.51e-297	1	486	1	485
QRG40491.1|GT22	2.40e-280	1	494	1	496
QEO24417.1|GT22	4.11e-280	1	494	1	496
QEL62905.1|GT22	1.18e-279	1	494	1	496
QWW25540.1|GT22	1.67e-279	1	494	1	496

PDB Hits     

CXQ85_004285-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6BH65|GPI10_DEBHA	9.02e-176	3	494	41	548	GPI mannosyltransferase 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GPI10 PE=3 SV=2
sp|Q5AK24|GPI10_CANAL	4.08e-155	6	495	11	482	GPI mannosyltransferase 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPI10 PE=3 SV=2
sp|Q6CAB8|GPI10_YARLI	8.35e-121	10	492	21	508	GPI mannosyltransferase 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI10 PE=3 SV=1
sp|Q6CN76|GPI10_KLULA	1.03e-97	3	492	6	597	GPI mannosyltransferase 3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=GPI10 PE=3 SV=1
sp|P30777|GPI10_YEAST	2.14e-97	6	492	16	601	GPI mannosyltransferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPI10 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999997	0.000000

TMHMM  Annotations     

Start	End
7	26
110	132
166	188
203	225
245	267
277	299
330	352