CAZyme Information: CXQ85_003418-t46_1-p1

Basic Information

• Species: [Candida] haemuloni
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] haemuloni
• CAZyme ID: CXQ85_003418-t46_1-p1
• CAZy Family: GT3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
437		49221.96	9.3872

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ChaemulonisB11899	5409	N/A	160	5249

• Gene Location: location=PKFO01000002:541607-542920(+)

Full Sequence      

MSLSTRSSPTYNPFMNAIGRLLVAILALKSIHIVIFYLSPTQFDISSAILLKKYESEKHV
LATAIHTSISPIDRLIERVVRSILDNIVDRFVIWDTVYFADQFTNGLTYEHQYVFCPLWW
RLIKLIPVNGKAVFYSNVICATLLSNICHFGAAVVLYYYTYIVFSQARLFPPQKMAELAS
LFFVLSPGAAFLTAPYSESIAALFSFTCLALREKALEFSMGAKYNTTSRKVLYLLSGVAA
ALSFGFRANCLLLGLIYIYDLFGRKTETPLLPLAAGSILGLAFLVSNIYNYVAICLSGDR
GEWCSNRIPSLFAYAQGHYWNIGLFKYWTLNNIPNFIFGAPTIGLSAFSIKYFAKEYPVS
RILPVSLVNAAFLTALLLSWHVQIVTRIHTFLPMMYWVAAGLWTHNDYPILKKVVFGYFI
VWNVVQPALFAAFLPPA

Enzyme Prediction     

No EC number prediction in CXQ85_003418-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	25	437	7.9e-89	0.9877149877149877

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	5.83e-38	92	437	58	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	4.61e-17	143	437	121	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWW21893.1|GT76	7.07e-209	15	437	1	423
QEL58691.1|GT76	1.00e-208	15	437	1	423
QWU86765.1|GT76	1.10e-201	17	413	2	398
SGZ51552.1|GT76	2.13e-153	15	437	1	427
SGZ50461.1|GT76	4.28e-153	15	437	1	427

PDB Hits     

CXQ85_003418-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6BRZ9|GPI18_DEBHA	1.96e-115	29	437	15	428	GPI mannosyltransferase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GPI18 PE=3 SV=1
sp|Q59VN0|GPI18_CANAL	2.72e-86	20	437	4	394	GPI mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPI18 PE=3 SV=1
sp|Q6FWN4|GPI18_CANGA	1.90e-54	15	437	1	433	GPI mannosyltransferase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=GPI18 PE=3 SV=1
sp|Q6CMW6|GPI18_KLULA	1.12e-50	90	437	56	417	GPI mannosyltransferase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=GPI18 PE=3 SV=1
sp|Q757K7|GPI18_ASHGO	3.81e-50	15	437	1	427	GPI mannosyltransferase 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000005

TMHMM  Annotations     

Start	End
21	43
118	140
147	169
189	211
231	253
268	290
328	350
360	382
414	436