CAZyme Information: CXQ85_003400-t46_1-p1

Basic Information

• Species: [Candida] haemuloni
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] haemuloni
• CAZyme ID: CXQ85_003400-t46_1-p1
• CAZy Family: GT2|GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
830		95376.24	4.8570

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ChaemulonisB11899	5409	N/A	160	5249

• Gene Location: location=PKFO01000002:495486-497978(-)

Full Sequence      

MLSTRLCTLLFILFATVLSIREQDKFDILNDQSFEEAPEDYEKVSHDSLLWGPYNSGRYL
GIRPRIPESLLSGLMWFNVDSQMGVSAARDFYEQGDNMARANWVQFDPRLGGRQVISDND
CHIDITIDFVKSDNGRNWAVKVKSVPHKGHENVKTSFVWYSGLQGERKGIDSQTANEGVL
KLDTPRDENGYKGTVKLSGFSEELGLFEIKINDGGSGTKNKHPDPPKGTLRELNSKRTHH
LSLRVPNHSVWQSRAIFMTLLKESVQEIVSTYEQDSEKFPPHVVYLIRNMNKYEGNLHFI
QKVFEGASEFDVVYSDVASPPTERITFGNIDNKIDEVLSKVNQNFKENFQLSKFSNKQQE
FGQEMLSGLLGGLSYFYGDHLVDRQSKLDSEDFSADGEGDGTELPKLKGELEGPFELFTL
VPSRPFFPRGFYWDEGFHLLPLLKYDSDLALEIIKSWFNLIDDDGWIAREQILGAESRSR
VPEAFQVQSPAIVNPPTIMLAFTYLLENSQKTKVEETVDLDEGDVKANIGRVVLNNPELL
ADYTRQIYPKLKSHFEMFRRTQQGSVEEFNRGDNYEAYRWRGRTVTHSLASGIDDYPRAL
PLDVAELNVDLLCWMGVMTRSIKMIAQVLELKDDEQHYTKIENDIIANVEAIHWSEKDKS
YCDVSVDDDDENVHVCHKGYISLFPFLTKMIPVESVDKIEHVVDQITDPEELWSEYGIRS
LSKSDEHYRTGENYWRAPVWININYLVLENLQYYHEATKPHASKELKKKIESAYSNLRKN
LIKNVFDQWEKTGFVWESYDDQSGDNKGAKNFLGWTSTILLMMEMPEKLT

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	605	824	1.4e-32	0.43508771929824563

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	325	825	1	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	1.38e-89	49	281	1	221	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	4.70e-06	539	774	356	570	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
283786	GDE_C	0.001	541	768	103	329	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWU86751.1|GH63	0.0	1	830	1	830
QEO21053.1|GH63	0.0	10	829	10	832
QEL58708.1|GH63	0.0	10	829	10	831
QWW21908.1|GH63	0.0	10	829	10	832
QRG36824.1|GH63	0.0	10	829	10	831

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	8.11e-209	36	820	2	797	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	1.09e-91	49	823	37	775	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P53008|CWH41_YEAST	4.20e-208	27	820	27	827	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|O14255|GCS1_SCHPO	4.16e-183	39	823	32	804	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|F4HTM3|GCS1_ARATH	2.47e-96	47	823	107	845	Mannosyl-oligosaccharide glucosidase GCS1 OS=Arabidopsis thaliana OX=3702 GN=GCS1 PE=1 SV=1
sp|Q84M89|GCS2_ARATH	9.40e-94	47	823	44	782	Alpha-glucosidase 2 OS=Arabidopsis thaliana OX=3702 GN=GCS2 PE=2 SV=1
sp|Q80UM7|MOGS_MOUSE	1.73e-93	49	823	92	830	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000221	0.999761	CS pos: 19-20. Pr: 0.9808

TMHMM  Annotations     

There is no transmembrane helices in CXQ85_003400-t46_1-p1.