CAZyme Information: CXQ85_003306-t46_1-p1

Basic Information

• Species: [Candida] haemuloni
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] haemuloni
• CAZyme ID: CXQ85_003306-t46_1-p1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
407	PKFO01000002|CGC3	46560.60	4.9708

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ChaemulonisB11899	5409	N/A	160	5249

• Gene Location: location=PKFO01000002:283192-284415(+)

Full Sequence      

MATAVLAASTVKRGKKASDWDYQNKKVEGVNLGGWFVLEPYITPSLFTAFGDKDVPVDEY
HYTKALGKEEAKKRLKKHWDTWYQEKDFKAIADAGINTVRIPIGYWAYGALDDDPYVSGQ
DYYLERAIGWARKHGLAVWIDLHGAPGSQNGFDNSGLRDTIGYQSDENISLTLTVLQAIF
DKYGGTDYEDVVSAIQFLNEPLGPASDVNQLKNFYRWAYGNMRSVSNNNVAIHDAFEQSE
GYWDSFMNVKDGYWKVVLDHHHYQVFSPGELAADIDDHIETACKWGPQHKKEYHWNLVGE
WSAALTDCAFWLNGVGRGARWSGDYDNSPNYGSCDTYTNPDKWTDEHKKNVRKYLEAQLD
AYSTASGWIFWNWKCEDAIDWDLSRLIKIGAFPQPFDDRQYPNQCVY

Enzyme Prediction     

EC	3.2.1.58:29	3.2.1.21:6	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	77	376	2.1e-123	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	4.66e-75	26	405	17	394	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	2.49e-06	78	230	15	162	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWU86673.1|GH5_9	3.96e-277	1	407	9	414
QRG36728.1|GH5_9	6.19e-270	1	407	9	415
QEO20957.1|GH5_9	6.19e-270	1	407	9	415
QEL58803.1|GH5_9	6.19e-270	1	407	9	415
QWW21995.1|GH5_9	1.46e-268	1	407	9	415

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	4.22e-182	20	405	2	391	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	8.50e-182	20	405	2	391	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	1.05e-181	20	405	8	397	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PC8_A	3.01e-181	20	405	8	397	Chain A, Hypothetical protein XOG1 [Candida albicans]
2PBO_A	3.01e-181	20	405	8	397	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12700|EXG_SCHOC	4.15e-196	8	405	23	423	Glucan 1,3-beta-glucosidase OS=Schwanniomyces occidentalis OX=27300 PE=3 SV=1
sp|Q8NKF9|EXG_CANOL	1.06e-191	3	407	13	425	Glucan 1,3-beta-glucosidase OS=Candida oleophila OX=45573 GN=EXG1 PE=3 SV=1
sp|P29717|EXG1_CANAL	1.03e-180	20	405	46	435	Glucan 1,3-beta-glucosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=XOG1 PE=1 SV=5
sp|O93983|EXG2_WICAO	1.02e-175	15	405	30	426	Glucan 1,3-beta-glucosidase 2 OS=Wickerhamomyces anomalus OX=4927 GN=EXG2 PE=3 SV=1
sp|Q875R9|EXG_LACK1	3.05e-163	20	405	41	437	Glucan 1,3-beta-glucosidase OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / BCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) OX=226302 GN=EXG1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000087	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CXQ85_003306-t46_1-p1.