CAZyme Information: CXQ85_002865-t46_1-p1

Basic Information

• Species: [Candida] haemuloni
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] haemuloni
• CAZyme ID: CXQ85_002865-t46_1-p1
• CAZy Family: GT15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
753		85967.02	8.7798

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ChaemulonisB11899	5409	N/A	160	5249

• Gene Location: location=PKFO01000010:961582-963843(+)

Full Sequence      

MSSNLKKRGKKTGTVTPTQAEPSTDPIADVEKTGLITTRKESESTYWIALVAVTVVAAFV
RFRILGHPAKVVFDEVHFGKFASYYLERTYFFDLHPPFAKLLIAFAGWIVGYDGAFKFEN
IGDNYVENNVPYLAYRSLSAIQGTAVVPVMFLTMKTLGFTVSACVLSSALVLFDNAQIID
SRLILLDATLILSVALTMFTYCKFSTYRRQPFSKWWWIWLLSTGVSLSCVISTKYVGVFT
YFTIGIAVIHELWILLDIRKGLTIEQFAQHFLARFFSLIVFPFVIYLFWFYLHFAILTKS
GPGDAFMSSDFQETLQESPLAKYSKAVHYNDVITIQHKDTEAFLHSHNLVYPLRYENGRI
SSNQQQVTCVYDQEGQEITDPNSQWEIVPTKKTSNDQGVYTNDVVRFKHVGTGGFLLTHD
VASPLLSTNEEFVVVHDEVAETRYNETLFRLRYAEAGNKNKRTLIKTKATPLRVVHVDTV
VAMWTHDDEVLPDWALEHQEVSGNKKVQDKDNSWSIDSIVNLKEDDPRNKYVPKKVKSIP
FLKKWWELQGLMFVHNNKLSSEHPFASQPDAWPLAVSGVSFWNDNDTRRQIFFIGNVIGF
WIEVGFLAVYVGFVLADLVTSRRAYDIITPAARSRLYNTLGFLFIGWAAHYFPFYLMGRQ
KFLHHYLPAHLIAALFTGGIVEFLCTNKTSQNKKGLAPGSIDKIRLIGATVTVIVGTAWF
LWYMRAMTYGNFAMAAEEVKKRQWLEINFHYAK

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	53	294	1.6e-64	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	61	753	38	699	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	5.98e-76	61	298	11	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	9.88e-66	543	746	1	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
397103	MIR	1.04e-14	339	514	7	183	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	6.46e-09	326	389	3	56	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWU88676.1|GT39	0.0	1	753	987	1739
QEO22200.1|GT39	0.0	1	753	1	755
QWW24051.1|GT39	0.0	1	753	1	755
QRG38981.1|GT39	0.0	1	753	1	755
QEL61332.1|GT39	0.0	1	753	1	755

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	2.73e-78	24	745	32	724	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	9.01e-76	54	730	72	734	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59X23|PMT4_CANAL	0.0	1	753	1	755	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|P46971|PMT4_YEAST	9.51e-250	18	753	27	762	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|O42933|PMT4_SCHPO	1.76e-188	10	746	27	768	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|Q8BGQ4|POMT2_MOUSE	6.22e-93	39	746	120	816	Protein O-mannosyl-transferase 2 OS=Mus musculus OX=10090 GN=Pomt2 PE=1 SV=1
sp|Q9UKY4|POMT2_HUMAN	1.44e-92	46	738	57	734	Protein O-mannosyl-transferase 2 OS=Homo sapiens OX=9606 GN=POMT2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999949	0.000044

TMHMM  Annotations     

Start	End
46	65
90	112
151	173
183	202
215	232
236	255
275	297
593	615
636	658
662	684
704	726