CAZyme Information: CXQ85_001955-t46_1-p1

Basic Information

• Species: [Candida] haemuloni
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] haemuloni
• CAZyme ID: CXQ85_001955-t46_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
505		56992.16	5.5185

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ChaemulonisB11899	5409	N/A	160	5249

• Gene Location: location=PKFO01000003:710437-711954(-)

Full Sequence      

MGLSKLVDKMRSHSVASVNAADPPVDAGQPPSRKQIFRARYNFGPNFGALFVGEKWIYHS
IFPDGAETELQAAEGNIKALGVDKAREKYENHWKHYVNDDDWQWLQDNGVTAIRLPIGYW
NIDGGKYTKGTKFEKVAGVYKNSWEIIKKNYIEPAGRFDIGVLIDIHGLPYGANGNDHSG
ETNNGKAEFWNKSSAQNLVIDALKFLAGDIANYENVAGIQIVNEAEFSNGASKQKKYYAD
AINAIRAVDKSVPVVISDGWWPDQWVKWVQDNQDIGTTIGVVVDHHVYRCFDGNDKKKDP
NQITDDLEGDLLTNLTDDGNGVDFMVGEWSCVLDGDSYSKAGLDPNDYGNQKRAELSSRF
GGRIADLIFKRAGGGSYFWTYKFESGNGGEWDFRQQLHNSFAPPKITVPDDNKFNEVLEG
NFKAHSDYWNSQNSNEKYEHDRYKEGFTVAWRDSVEFAKQGSLLGRRQAVKCARLKEHID
AKGKSKFLWEWEQGYDKGIEEFNNL

Enzyme Prediction     

No EC number prediction in CXQ85_001955-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	88	389	4.6e-122	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.68e-27	51	307	25	261	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	0.004	94	329	21	236	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWU86148.1|GH5_49	0.0	1	505	1	505
QEO19646.1|GH5_49	0.0	1	505	1	505
QEL59437.1|GH5_49	0.0	1	505	1	505
QWW22528.1|GH5_49	0.0	1	505	1	505
QRG36096.1|GH5_49	0.0	1	505	1	505

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	1.95e-18	44	407	11	383	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	2.62e-18	44	407	11	383	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	2.75e-18	44	407	17	389	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
3O6A_A	4.91e-18	44	407	16	388	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
3N9K_A	6.58e-18	44	407	16	388	F229A/E292S Double Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38081|YBQ6_YEAST	2.07e-99	23	503	27	499	Uncharacterized glycosyl hydrolase YBR056W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YBR056W PE=1 SV=1
sp|O74799|EXG3_SCHPO	7.28e-93	32	494	4	444	Glucan 1,3-beta-glucosidase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=exg3 PE=3 SV=1
sp|B8N151|EXGA_ASPFN	1.52e-26	44	414	33	401	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
sp|Q7Z9L3|EXGA_ASPOR	1.52e-26	44	414	33	401	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
sp|A2RAR6|EXGA_ASPNC	4.21e-24	14	414	14	411	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000040	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CXQ85_001955-t46_1-p1.