CAZyme Information: CXQ85_000923-t46_1-p1

Basic Information

• Species: [Candida] haemuloni
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] haemuloni
• CAZyme ID: CXQ85_000923-t46_1-p1
• CAZy Family: GH130
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
283		30070.43	4.7008

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ChaemulonisB11899	5409	N/A	160	5249

• Gene Location: location=PKFO01000001:98803-99654(+)

Full Sequence      

MQFATILFAALVAAAPTKRETTCKFPDNKGLVSVTSSKSNAGWALSPDQKCTAGSYCPYA
CPPGQLMAQWDKSAKSYTTGSSMNGGYFCNDDGELEKPFSDKDLCVNGTGTVEVNNKANK
NVAFCQTVLPGNEAMLIPTDVDGGNTRTLAVPDEDYYASSAAHYYINPLGVSTDDGCVWG
TKDKAQGNWAPYVAGANTDSSGNTYVKIGWNPKYIDDFKDKPSFGVRVTCADGECNGLDC
EIDPSKDGYNGINGKDTGKSLGASYCVVTAKNKNKATIEVFSV

Enzyme Prediction     

No EC number prediction in CXQ85_000923-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	19	275	5.8e-90	0.8250825082508251

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	1.45e-116	18	267	1	244	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWU89555.1|GH132	1.03e-201	1	283	1	283
QEO22520.1|GH132	8.56e-185	1	283	1	283
QWW23484.1|GH132	8.56e-185	1	283	1	283
QRG37882.1|GH132	1.22e-184	1	283	1	283
QEL60559.1|GH132	9.99e-184	1	283	1	283

PDB Hits     

CXQ85_000923-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q04018|YM79_YEAST	1.17e-107	18	283	46	319	Uncharacterized protein YMR244W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YMR244W PE=3 SV=1
sp|O74851|ADG3_SCHPO	7.22e-86	18	280	67	333	Probable secreted beta-glucosidase adg3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=adg3 PE=2 SV=1
sp|P46955|NCA3_YEAST	1.45e-37	25	233	91	301	Beta-glucosidase-like protein NCA3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NCA3 PE=3 SV=1
sp|B3LRC2|UTH1_YEAS1	2.43e-37	25	233	116	326	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain RM11-1a) OX=285006 GN=UTH1 PE=3 SV=1
sp|A7A003|UTH1_YEAS7	2.43e-37	25	233	116	326	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=UTH1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000231	0.999732	CS pos: 19-20. Pr: 0.9372

TMHMM  Annotations     

There is no transmembrane helices in CXQ85_000923-t46_1-p1.