CAZyme Information: CXQ85_000892-t46_1-p1

Basic Information

• Species: [Candida] haemuloni
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] haemuloni
• CAZyme ID: CXQ85_000892-t46_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
207	PKFO01000001|CGC7	23084.30	5.5776

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ChaemulonisB11899	5409	N/A	160	5249

• Gene Location: location=PKFO01000001:22926-23549(+)

Full Sequence      

MSILFTTGATVTFHKLVDYVVDPSFLSSLHNIGYSKFAIQFGNEVSPTQHISKKYFSDAI
ASNQLMEKLDLSIQNEFNDKSVTRLGSPDLSITVFPFAPSINDYIADADIVVSHAGTGSI
LDVLRLGKPLIVVTNQDLMNDHQEEVAAQFEKLGYLYRVNTSEMLQGKLLDLITRFKKGS
LRFSHMSAPPDGVIEQVLSEELERARR

Enzyme Prediction     

No EC number prediction in CXQ85_000892-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	87	187	1.7e-16	0.6178343949044586

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397977	Glyco_tran_28_C	3.21e-23	82	174	46	142	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.
227350	COG5017	7.59e-19	95	163	53	125	UDP-N-acetylglucosamine transferase subunit ALG13 [Carbohydrate transport and metabolism].
223779	MurG	8.08e-15	54	176	196	321	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
340818	GT28_MurG	2.38e-09	92	188	237	333	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
224732	YjiC	4.97e-08	104	204	297	401	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRG37914.1|GT1	5.21e-130	1	207	1	207
QEL60529.1|GT1	8.63e-129	1	207	1	207
QEO22550.1|GT1	8.63e-129	1	207	1	207
QWW23456.1|GT1	2.86e-125	1	205	1	205
QWU89529.1|GT1	1.11e-112	1	207	1	209

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2KS6_A	1.41e-22	2	163	7	165	NMR solution structure of ALG13 --- obtained with iterative CS-Rosetta from backbone NMR data. [Saccharomyces cerevisiae]
2JZC_A	2.31e-22	2	163	30	188	NMR solution structure of ALG13: The sugar donor subunit of a yeast N-acetylglucosamine transferase. Northeast Structural Genomics Consortium target YG1 [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ABE5|ALG13_CANAL	3.45e-40	2	204	76	293	UDP-N-acetylglucosamine transferase subunit ALG13 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ALG13 PE=3 SV=2
sp|Q6BST1|ALG13_DEBHA	2.63e-39	2	202	3	210	UDP-N-acetylglucosamine transferase subunit ALG13 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=ALG13 PE=3 SV=2
sp|Q6FVR6|ALG13_CANGA	5.42e-25	1	181	1	177	UDP-N-acetylglucosamine transferase subunit ALG13 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=ALG13 PE=3 SV=1
sp|Q6CXY0|ALG13_KLULA	1.59e-23	2	166	4	166	UDP-N-acetylglucosamine transferase subunit ALG13 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=ALG13 PE=3 SV=1
sp|P53178|ALG13_YEAST	7.43e-22	2	163	8	166	UDP-N-acetylglucosamine transferase subunit ALG13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG13 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000066	0.000001

TMHMM  Annotations     

There is no transmembrane helices in CXQ85_000892-t46_1-p1.