CAZyme Information: CXQ85_000828-t46_1-p1

Basic Information

• Species: [Candida] haemuloni
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] haemuloni
• CAZyme ID: CXQ85_000828-t46_1-p1
• CAZy Family: GH125
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
605	PKFO01000005|CGC7	68608.99	6.6083

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ChaemulonisB11899	5409	N/A	160	5249

• Gene Location: location=PKFO01000005:1936785-1938602(-)

Full Sequence      

MALKTMSVRGWKPIQLIIIVGAVVLFYLWRFQRADDTYSREKLYSSSILADEDSGYVDAE
DSVVQNGNSEIASSGKWVDDITPEFLSELDQKTDKCINYVDYSKKAHAPYSKGKFRYPFM
RPPLKCRTFASEAVEKLITDLKSKIKNPDLARLVENCLPNTLDTTILWHKDGLASSGKLS
KYPESFVVTGDIHAEWLRDSARQLSVYQPLVKYDEKLKQLIKGAIHTQEQYIMNSPYCNA
FHPPPGSGVEKGNTAKDAVYPKPDWNQVFECKYEIDSLASFLTLTNEYIDNTGDTSVFTK
SWIKAYEKILIVLKRESQPSFDPGNGDVLPFYYSFKRDTNIGSETLPLDGVGNPVNFNTG
LIRSAFRPSDDSTILQFFVPGNAHMLTELKRTRKHLFENDVKLNVDLTIHKEHTDTFIEG
IERGLKENAVVDHPKWGKVYAFETDGYGSNVFMDDANIPSLLALPDLGYLDVNDETYQRT
RKMILSKSGNPYYLTGRHFEGIGGPHIGIENAWPMSLLMRIRTTDDDNEIIKSLKYVMGT
TAGLGLMHESVKVNSMKGLSYTRPWFAWCNSEFGKTILHLAKHKPHLIFKEEFASTPYSL
ESVFA

Enzyme Prediction     

No EC number prediction in CXQ85_000828-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	147	578	1.2e-157	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	147	578	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	7.15e-153	126	587	2	429	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWU89004.1|GH125	0.0	1	605	1	600
QRG39809.1|GH125	0.0	1	604	1	601
QEO23847.1|GH125	0.0	1	604	1	601
QWW24495.1|GH125	0.0	1	604	1	601
SGZ55569.1|GH125	4.19e-299	8	605	10	606

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ON6_A	2.33e-106	117	580	19	448	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3P2C_A	1.38e-105	121	580	21	450	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
2P0V_A	1.84e-103	117	580	39	468	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
6RQK_A	7.87e-79	132	577	10	419	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
3QT3_A	8.82e-79	132	577	10	419	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	1.81e-167	85	590	16	506	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999988	0.000034

TMHMM  Annotations     

Start	End
7	29