CAZyme Information: CXQ85_000725-t46_1-p1

Basic Information

• Species: [Candida] haemuloni
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] haemuloni
• CAZyme ID: CXQ85_000725-t46_1-p1
• CAZy Family: CE9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393		41344.15	5.1350

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ChaemulonisB11899	5409	N/A	160	5249

• Gene Location: location=PKFO01000005:1675732-1676913(+)

Full Sequence      

MRFAKASIASLAFASVASALPAYNKRDEDCSSTQVHVHHKHKREVVYEYAYVTVTVNGAG
SIQGSPSTAVEEPTSSTEAETTSSSVITSSSFSTETPSSSPASSTGASTSSSGSTPTGGD
HGIWGDLGDYQGPYNEFQDGVHSCDSFPVGDGVISLSHLGFGGWSGIYNSDTSTGGKCQE
GSYCSYACQSGMSKTQWPSNQPSNGVSVGGLLCKNGKLYRTNKDTQYLCEWGKDTAIVEN
KLGQVVSVCRTDYPGTENMVIPTVANPGKSIALTTVDSDTYYTWKGLPTSAQYYVNDAGV
GYQDGCLWGSAGSGVGNWAPLNFGAGWTNGIAYLSLIPNPNNRDATNYRVKIVADGNSVV
NGECVYENGKYNGNGHDGCTVAVTSGRAKFVFY

Enzyme Prediction     

No EC number prediction in CXQ85_000725-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	93	393	7e-124	0.9537953795379538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	3.90e-138	139	380	1	244	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWU89100.1|GH132	3.60e-201	1	393	1	399
QEO23248.1|GH132	2.30e-183	1	393	1	390
QWW24594.1|GH132	1.32e-182	1	393	1	390
QRG39705.1|GH132	3.78e-182	1	393	1	390
QEL61839.1|GH132	9.83e-173	57	393	26	360

PDB Hits     

CXQ85_000725-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59NP5|SUN41_CANAL	2.26e-139	121	393	145	417	Secreted beta-glucosidase SUN41 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SUN41 PE=1 SV=2
sp|P53616|SUN4_YEAST	1.37e-133	123	393	149	419	Probable secreted beta-glucosidase SUN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUN4 PE=1 SV=1
sp|P40472|SIM1_YEAST	6.03e-133	123	393	205	475	Probable secreted beta-glucosidase SIM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIM1 PE=1 SV=2
sp|Q5AKU5|UTH1_CANAL	1.47e-113	123	393	103	372	Secreted beta-glucosidase SIM1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SIM1 PE=1 SV=1
sp|B3LRC2|UTH1_YEAS1	7.89e-111	136	393	105	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain RM11-1a) OX=285006 GN=UTH1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000351	0.999640	CS pos: 26-27. Pr: 0.8429

TMHMM  Annotations     

There is no transmembrane helices in CXQ85_000725-t46_1-p1.