CAZyme Information: CXQ85_000707-t46_1-p1

Basic Information

• Species: [Candida] haemuloni
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] haemuloni
• CAZyme ID: CXQ85_000707-t46_1-p1
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396	PKFO01000005|CGC9	44898.60	5.1873

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ChaemulonisB11899	5409	N/A	160	5249

• Gene Location: location=PKFO01000005:1623821-1625011(-)

Full Sequence      

MTLTNPNLEGYAIARGMWLYFYNPNERKFKAPKKCSGCYNNDTFVVWAVSVAAQAIVDGA
RIYPELTPLIGPAIDTFQRYKNHHTKGYSAAENSGNDNDVYYDDDAQVASAMLTAYEVTG
DKRFLDQGRELTRFLMGGWHPKIGGVKWHVSKTYVNACTTAEVAKACLQISKFIPDEAKT
YVDFAAKCTQWQIDTLQDKGDKCIIDGVQPDGMKFENGKLTYNTGTTLSCAAHLWHITKD
EKWKTIADDLAKAAINPNVPFYDRDYPNELRYWRDPNYWTQLLIEGLADYLLYVGSDAPE
GLPKQIHDEVLRNILMYYKYAKDPEDGLYIQSFEPNRTYPEKAELYQEEFGGKKDVSLKG
EDSDNGKPQKCLMGLGAAARVFFQAARIVPEINYDE

Enzyme Prediction     

No EC number prediction in CXQ85_000707-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	11	325	3.1e-48	0.8268156424581006

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	3.15e-25	12	304	8	305	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	3.51e-06	106	234	96	221	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWU89116.1|GH76	2.91e-274	1	395	1	395
QWW24611.1|GH76	1.96e-272	1	395	1	396
QEO23230.1|GH76	1.96e-272	1	395	1	396
QEL61860.1|GH76	1.96e-272	1	395	1	396
QRG39687.1|GH76	5.62e-272	1	395	1	396

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6U4Z_A	5.43e-15	82	254	213	392	Crystal Structure of a family 76 glycoside hydrolase from a bovine Bacteroides thetaiotaomicron strain [Bacteroides thetaiotaomicron]
4C1S_A	7.97e-15	88	254	95	268	Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],4C1S_B Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14131|MU191_SCHPO	2.29e-38	35	393	35	418	Meiotically up-regulated gene 191 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug191 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999720	0.000297

TMHMM  Annotations     

There is no transmembrane helices in CXQ85_000707-t46_1-p1.