CAZyme Information: CXQ85_000352-t46_1-p1

Basic Information

• Species: [Candida] haemuloni
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] haemuloni
• CAZyme ID: CXQ85_000352-t46_1-p1
• CAZy Family: CBM21
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
557	PKFO01000005|CGC10	59388.61	4.3354

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ChaemulonisB11899	5409	N/A	160	5249

• Gene Location: location=PKFO01000005:805098-806771(-)

Full Sequence      

MLFHSLLTTAVALIGSASATLPPIEIVGNKFYFSNNGSQFLMRGIAYQQNPTNTSSDAKY
VDPLADIETCKRDIPYLRQLNTNILRVYALDAEKDHTECMKLLDDAGIYIVADLSEPNLS
IDRSNPAWDTELLARYTSVVDKFSNYTNVLGFFAGNEVTNESNNTDASAYVKAAVRDTKA
YIKEKNYRNIPVGYSANDDMAIRVELADYFACGSDEDRADFFGINMYEWCGTSTFKDSGY
KNVTNAYKDLGIPIFFSEYGCNEIRPRKFQEVGTLYSSEMTDIWSGGIVYMYFEEENKYG
LVTVSGSSVSTLKDFENYSSEINKISPSYASFDTAASTSPASVTSCPGVGEVWQAATALP
PTPDASLCECMDKSLSCVVKDKVDEDDYSDLFDFLCGSDGVNCFGISGNGTTGKYGAYSA
CKSKQKLNFLLDLYYKENGSKASACDFSGSATTQSAATASSCAKEISEAGVSGYGTVTGN
ILNAASGAQSATSGSGSKSSGSGSGSRSGSSSGSSSSSTSSSDSGASGNVAMRGSSGNTA
LVMIATFFFVSVGLTMA

Enzyme Prediction     

EC	2.4.1.-:30	2.4.1.-:33

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	19	325	4.3e-140	0.9903846153846154
CBM43	376	462	8.6e-20	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	4.03e-176	15	326	3	315	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
400371	X8	1.03e-28	375	452	1	76	X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains.
197867	X8	7.12e-19	375	462	1	83	Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges.
397119	Glyco_hydro_2_C	3.86e-06	24	260	1	211	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
395098	Cellulase	0.003	105	260	76	237	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWU89385.1|CBM43|GH72	1.49e-295	1	492	1	492
QEL60254.1|CBM43|GH72	7.89e-276	1	494	1	489
QWW23216.1|CBM43|GH72	1.59e-275	1	494	1	489
QEO20302.1|CBM43|GH72	6.45e-275	1	494	1	489
QRG38185.1|CBM43|GH72	6.46e-274	1	494	1	489

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W62_A	6.17e-132	22	445	34	466	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]
2W61_A	1.74e-131	22	445	34	466	Saccharomyces cerevisiae Gas2p apostructure (E176Q mutant) [Saccharomyces cerevisiae]
5FIH_A	1.74e-131	22	445	34	466	SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P56092|EPD1_CANMA	1.16e-226	2	490	6	489	Protein EPD1 OS=Candida maltosa OX=5479 GN=EPD1 PE=3 SV=1
sp|O13318|PHR2_CANAL	5.73e-216	2	481	6	480	pH-responsive protein 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PHR2 PE=2 SV=2
sp|P43076|PHR1_CANAL	2.70e-200	19	467	24	478	pH-responsive protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PHR1 PE=2 SV=4
sp|P22146|GAS1_YEAST	1.59e-199	1	491	1	490	1,3-beta-glucanosyltransferase GAS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAS1 PE=1 SV=2
sp|O74137|EPD2_CANMA	2.57e-188	18	460	24	471	Protein EPD2 OS=Candida maltosa OX=5479 GN=EPD2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000352	0.999629	CS pos: 19-20. Pr: 0.9725

TMHMM  Annotations     

There is no transmembrane helices in CXQ85_000352-t46_1-p1.