CAZyme Information: CXQ85_000160-t46_1-p1

Basic Information

• Species: [Candida] haemuloni
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] haemuloni
• CAZyme ID: CXQ85_000160-t46_1-p1
• CAZy Family: AA4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
742	PKFO01000005|CGC3	83783.03	7.7749

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ChaemulonisB11899	5409	N/A	160	5249

• Gene Location: location=PKFO01000005:363656-365884(-)

Full Sequence      

MTKPSTVLGVKIDTVRLLLRTVIFISIAGAAISSRLFSVIRFESIIHEFDPWFNFRATKY
LVSHSFYDFLNWFDDRTWYPLGRVTGGTLYPGLMVTSGIIWHALRDWFGLPVDIRNICVM
LAPAFSGITAIFTYYFTKEMKDSNAGLLAAIFMGIAPGYISRSVAGSYDNEAIAITLLMA
TFYLWIKAMKVGSIFYGTLTALSYFYMVSAWGGYVFITNLIPLHVFVLILMGRYNHRLYT
AYTTWYALGTIASMQIPFVGFLPIRSNDHMAALGVFGLLQLVAFGAYVRSNVPTAQFKVF
LTVSLFLTTVLGIAGLTALTAAGWIAPWTGRFYSLWDTNYAKIHIPIIASVSEHQPTAWP
AFFFDTNMLIWLFPAGVFFCFQELRDEHLFIIIYGVLGSYFAGVMVRLMLTLTPVVCVSA
AIALSKLFDVYMDFTDIFSSESVEEEVTDKKKKVSAQKSKPFPLFKLLSKGVVLASFVYY
LVFFVLHCTWVTSNAYSSPSVVLASRNPDGSQNIIDDYREAYYWLRMNTPEDAKVMAWWD
YGYQIGGMADRTTLVDNNTWNNTHIATVGKAMASNEEAAYDILKKHDVDYVLVIFGGVLG
YSGDDMNKFLWMVRISEGIWPDDIHERDYFSAKGEYKVDGDASPTMKNCMLYKMSYYRFA
ELFGGRDAQDRARGQNIPSDPITLDTVEEAFTSQNWIVRIYKVKDLDNLGREPKAAAEFE
RGSAGSNKRVRAVKKPALDLRV

Enzyme Prediction     

EC	2.4.99.18:21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	17	662	1.1e-192	0.8571428571428571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396873	STT3	8.46e-163	18	497	1	478	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
224206	Stt3	4.44e-129	16	736	16	761	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].
224720	ArnT	0.004	120	203	88	172	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWU87245.1|GT66	0.0	1	742	756	1497
QRG38406.1|GT66	0.0	1	741	1	742
QEL60034.1|GT66	0.0	1	741	1	742
QEO20766.1|GT66	0.0	1	741	1	742
QWW23032.1|GT66	0.0	1	732	1	733

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6C26_A	0.0	18	742	15	718	The Cryo-EM structure of a eukaryotic oligosaccharyl transferase complex [Saccharomyces cerevisiae S288C],6EZN_F Cryo-EM structure of the yeast oligosaccharyltransferase (OST) complex [Saccharomyces cerevisiae S288C],7OCI_F Chain F, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 [Saccharomyces cerevisiae S288C]
6S7T_A	8.80e-290	30	719	83	791	Cryo-EM structure of human oligosaccharyltransferase complex OST-B [Homo sapiens]
6FTG_5	3.90e-278	18	710	17	701	Subtomogram average of OST-containing ribosome-translocon complexes from canine rough microsomal membranes [Canis lupus familiaris],6FTI_5 Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Programmed 80S Ribosome [Canis lupus familiaris]
6S7O_A	4.49e-277	18	710	17	701	Cryo-EM structure of human oligosaccharyltransferase complex OST-A [Homo sapiens]
6FTJ_5	4.33e-275	18	705	17	696	Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Non-programmed 80S Ribosome [Canis lupus familiaris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P39007|STT3_YEAST	0.0	18	742	15	718	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STT3 PE=1 SV=2
sp|O94335|STT3_SCHPO	0.0	19	742	24	752	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=stt3 PE=3 SV=1
sp|Q3TDQ1|STT3B_MOUSE	1.25e-290	30	714	80	783	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Mus musculus OX=10090 GN=Stt3b PE=1 SV=2
sp|E2RG47|STT3B_CANLF	1.59e-289	30	719	83	791	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Canis lupus familiaris OX=9615 GN=STT3B PE=1 SV=1
sp|Q8TCJ2|STT3B_HUMAN	4.53e-289	30	719	83	791	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000016	0.000006

TMHMM  Annotations     

Start	End
17	39
79	101
114	136
146	166
173	195
210	232
245	264
269	291
303	325
359	381
388	410
472	491