CAZyme Information: CXQ85_000010-t46_1-p1

Basic Information

• Species: [Candida] haemuloni
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] haemuloni
• CAZyme ID: CXQ85_000010-t46_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
825		91125.88	5.6996

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ChaemulonisB11899	5409	N/A	160	5249

• Gene Location: location=PKFO01000005:19163-21640(+)

Full Sequence      

MEVKQIDIEDVISKLTVEEKAYLISGRDFWHTYPVHRLGIPSLRFSDGPYGVRGTKFTDA
VPTASIPSGTVLACSWNTDLMYELGKMMGDQARAKGAHLVLGPTINMARSPLGGRSFESF
GEDPVLTGLLASALSSGIKDRKMMICPKHLACNDKEDDRTAMNVELSERALREIYMLPFM
IVQKKNDPESYMTAYNKIRGKHGSENEYLMREIVEKEWGFKGCFMSDWFGTVSTADSINA
GLHLEMPGPPIWRGKLVENCVQHRTVTEESLNEAVRGVLTLVNGAAKSGIPEDAYEGQLH
NKEVIALNRQAAREALVLLRNENILPLQKKKVLVIGESAKKANYCAGGACTVNAYHPVSM
YDALVENLGESNVDWVIGAPNRKILPSLGSYAKEQSKKPIKYCTYDEPRSVKDRKVISEL
TIPEVSVMMFEYDPATIRPGHHLHATFSVTINVPESAKYRFNLKVGGSAWVLIDGEVKAT
HINNYKSGSDMGMNAPVIFSEVYLEAGKDYLFEVDFESTSGKGGMSAGCLYCGLEKAVAP
EEYIKEAVELAKKYEQVIVITGLNKDFETEGIDRSTMGMPPYQDLLVESVLDSNPNSVII
VESGTAVTLPWEKKAKALLHSGYLGEELGNAIYDVVFGDYNPSGKLTYTWPKRYEDNSSA
TSFELDKSYSLTYLDDIYMGYRHNDISKIEPLFAFGHGLSYTSFAFDNLKVDVGEESIQL
SVDVKNTGAIDGSAVVQAYVLPKNSSVPVAVKSLKGFTKVFCKAGTSITANISLDKKLAC
SFYNTNIKQWTLEAGDYEVAVGSSSDKLEATKTFKIEKSTNWTML

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	35	247	1.7e-55	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.40e-60	37	809	101	758	beta-glucosidase BglX.
224389	BglX	1.22e-55	27	345	47	370	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	4.80e-42	536	701	73	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	7.89e-35	11	802	56	769	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.23e-30	37	281	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWW24396.1|GH3	0.0	1	825	93	917
QRG38583.1|GH3	0.0	1	825	1	825
QEO21808.1|GH3	0.0	1	825	1	825
QWU87117.1|GH3	0.0	1	825	1	825
QEL60940.1|GH3	0.0	1	825	1	821

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	5.61e-193	7	822	5	842	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.74e-187	7	822	5	842	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.10e-124	6	818	3	676	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	4.57e-100	12	817	9	664	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	1.38e-89	10	816	56	828	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WU49|BGLI_ASPFU	1.17e-210	5	822	3	835	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	1.17e-210	5	822	3	835	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	2.33e-210	5	822	3	835	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	3.82e-209	5	822	3	836	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	2.95e-208	5	822	3	835	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000040	0.000005

TMHMM  Annotations     

There is no transmembrane helices in CXQ85_000010-t46_1-p1.