CAZyme Information: CVL08794.1

Basic Information

• Species: Fusarium mangiferae
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium mangiferae
• CAZyme ID: CVL08794.1
• CAZy Family: GT71
• CAZyme Description: GH16 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1L7UDP4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312	FCQH01000026|CGC2	33898.06	6.3302

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FmangiferaeMRC7560	16149	N/A	345	15804

• Gene Location: location=FCQH01000026:77414-78399(+)

Full Sequence      

MDGSLHIHPWRDPTAAKGWTSGRIESTYTFTPAPGVKTIVQAGISLGLAREARKYGIWPA
FWLLGDSHRTGGPIWPACGELDIMEHVNGEHETYAAIHCDKSPGGICKEKKGITGSHYQP
NSATGLNTYKVVIDRTPAMWQYESVNFYVGDELFHTITGGHIGNLEVWKTIAQNKMFIIL
NVAVGGDWPGPPVPSTSEGPEVGMQVGYVAHYEQEASAEDTAHASYNYPYGNPADEMDYP
YDNIPQSPPPPAPPLPPVAVPPPASVGAPPPPPVGPPVGAPPYSYPHIRQVPHHPHQRPY
NYSNLPPGRPPY

Enzyme Prediction     

No EC number prediction in CVL08794.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	2	212	1.5e-40	0.8130434782608695

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185691	GH16_Strep_laminarinase_like	1.35e-84	2	213	53	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
185693	GH16_laminarinase_like	2.14e-35	2	212	44	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185683	Glyco_hydrolase_16	1.41e-11	1	212	36	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
225182	BglS	1.90e-11	50	238	121	294	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185690	GH16_fungal_Lam16A_glucanase	9.39e-07	56	105	95	141	fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Group of fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Lam16A belongs to the 'nonspecific' 1,3(4)-beta-glucanase subfamily, although beta-1,6 branching and beta-1,4 bonds specifically define where Lam16A hydrolyzes its substrates, like curdlan (beta-1,3-glucan), lichenin (beta-1,3-1,4-mixed linkage glucan), and laminarin (beta-1,6-branched-1,3-glucan).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT75467.1|GH16_3	3.00e-186	1	312	73	410
QGI70745.1|GH16_3	2.59e-184	1	312	73	410
QGI88090.1|GH16_3	2.59e-184	1	312	73	410
QGJ01636.1|GH16_3	2.59e-184	1	312	73	410
QKD62500.1|GH16_3	3.23e-104	2	251	74	354

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DGT_A	9.03e-38	2	190	65	250	The 1.5 A crystal structure of endo-1,3-beta-glucanase from Streptomyces sioyaensis [Streptomyces sioyaensis]
7EO3_A	2.55e-31	2	213	66	279	Chain A, 1,3-beta-glucanase [Actinomycetia bacterium]
3ATG_A	8.39e-23	19	220	68	246	endo-1,3-beta-glucanase from Cellulosimicrobium cellulans [Cellulosimicrobium cellulans]
6JH5_A	8.68e-21	2	214	48	233	Structure of Marine bacterial laminarinase [Aquimarina]
6JHJ_A	6.08e-20	2	214	48	233	Structure of Marine bacterial laminarinase mutant-E135A [Aquimarina],6JIA_A Marine bacterial laminarinase mutant E135A complex with laminaritetraose [Aquimarina sp.],6M6P_A Structure of Marine bacterial laminarinase mutant E135A in complex with 1,3-beta-cellotriosyl-glucose [Aquimarina sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9ZG90|KSBGL_SPHMU	5.20e-17	33	213	121	288	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
sp|P45798|GUB_RHOMR	6.28e-13	49	190	127	261	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
sp|Q27082|CFGA_TACTR	1.90e-12	56	225	115	265	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CVL08794.1.