CAZyme Information: CVL07636.1

Basic Information

• Species: Fusarium mangiferae
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium mangiferae
• CAZyme ID: CVL07636.1
• CAZy Family: GT31
• CAZyme Description: Related to SUR1-required for mannosylation of sphingolipids [Source:UniProtKB/TrEMBL;Acc:A0A1L7UK96]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	FCQH01000020|CGC6	41381.53	6.3990

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FmangiferaeMRC7560	16149	N/A	345	15804

• Gene Location: location=FCQH01000020:471052-472187(-)

Full Sequence      

MSSSPILGPERKNSYDEERLEWATPSVPKKYLRLPRLRRSTVILLLIDFLIIAVLVHAFY
PLITLLRRNEELFGARLTLPLNDTSFGEDVPAQRTIPRIFHQTSANETIPEAWKDLVKSC
RETYSEFEYKHWTDAKAHDFISEEYPWFLDTWDTFPFNIQRADAIRYFVLHHYGGIYLDM
DTLCNATIPLHQIEADGTKHHAVFKSTTPTGVSNDMMITSAHHPAFTKALSRIQLYNDIT
RPWAHILPHVAVMVSAGPLFLTMALKNYLLEQPSLPETTIQVINATELEPYLTDYEGASW
HHGDTKAIMWLGDHSWVWYVLTVVGVVGGLYLINMLLMKCWARFFEKASSDEAKDAIKLT

Enzyme Prediction     

No EC number prediction in CVL07636.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	112	188	1.6e-22	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	9.42e-42	89	318	75	297	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.50e-20	110	189	1	84	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI70654.1|GT32	1.54e-269	1	360	1	360
QGJ01544.1|GT32	1.54e-269	1	360	1	360
QGI87998.1|GT32	1.54e-269	1	360	1	360
CCT75359.1|GT32	1.54e-269	1	360	1	360
QKD62461.1|GT32	8.79e-260	1	360	1	360

PDB Hits     

CVL07636.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UT67|IMT2_SCHPO	1.31e-48	69	314	55	295	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P33300|SUR1_YEAST	3.36e-47	77	359	27	310	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	6.70e-44	37	314	1	273	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	1.34e-40	96	325	57	276	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	4.34e-40	78	315	45	276	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000028	0.000007

TMHMM  Annotations     

Start	End
41	63
243	265
316	338