CAZyme Information: CVL06057.1

Basic Information

• Species: Fusarium mangiferae
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium mangiferae
• CAZyme ID: CVL06057.1
• CAZy Family: GH93
• CAZyme Description: Pectinesterase domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1L7UEC5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406		44189.61	8.4162

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FmangiferaeMRC7560	16149	N/A	345	15804

• Gene Location: location=FCQH01000017:160536-161808(-)

Full Sequence      

MKGFIIKTAVIAATLFSTATASAKGPVDTYKKCQRQTKRATEGCPKGTLFVAKDDPRADF
SSIQKAIDSLGNTTTAGHILIAPGNYSEQLNVTRRGPLHLIGASNKPWVKDLYADIDVNT
TAQNDVQIWFNLANTNNGSLSDNVFTSVLTVGPNFNATLTGSGPTGFPVPEDTPFGCTDF
RAYNIDFRNDFAPQSVGPAHAVGVSRANAGFYSCGFYSYQDTVYVGKLGNAYFYDNIIAG
QTDFLYGFGTAWIEKSTLSLRGCGGGITAWKGTNTTFTNKYGVYIDNSQLIPVNSTIATN
FVGKCALGRPWNSQHKSIFMQSYFDAVILPAGYIEWSKSTPRVDNYTFMATWNDHGPGYN
VEAEKASNVTKVLTDAEVKPYRAPADVFQTPEGKFGHVKWIDKKAL

Enzyme Prediction     

No EC number prediction in CVL06057.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	51	381	7.2e-55	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178051	PLN02432	6.57e-25	57	381	20	280	putative pectinesterase
178372	PLN02773	5.25e-22	45	339	3	252	pectinesterase
215367	PLN02682	4.28e-21	45	381	67	355	pectinesterase family protein
215383	PLN02713	5.80e-19	180	360	342	520	Probable pectinesterase/pectinesterase inhibitor
395871	Pectinesterase	3.28e-17	180	361	89	268	Pectinesterase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI78782.1|CE8	7.58e-307	1	406	1	406
CCT65443.1|CE8	7.58e-307	1	406	1	406
QGI61595.1|CE8	7.58e-307	1	406	1	406
QKD51850.1|CE8	4.03e-302	1	406	1	406
QPC73408.1|CE8	2.88e-270	1	406	1	406

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	4.49e-21	45	373	7	287	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	6.14e-21	45	373	7	287	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1XG2_A	1.32e-07	214	381	125	292	Chain A, Pectinesterase 1 [Solanum lycopersicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QK82|PMEA_ASPNC	2.89e-21	15	373	10	315	Probable pectinesterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	3.40e-18	45	346	32	284	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1
sp|Q9SIJ9|PME11_ARATH	7.10e-17	57	377	58	316	Putative pectinesterase 11 OS=Arabidopsis thaliana OX=3702 GN=PME11 PE=3 SV=1
sp|Q8RXK7|PME41_ARATH	8.01e-17	179	358	348	525	Probable pectinesterase/pectinesterase inhibitor 41 OS=Arabidopsis thaliana OX=3702 GN=PME41 PE=2 SV=2
sp|Q9SRX4|PME7_ARATH	8.09e-17	148	360	318	533	Probable pectinesterase/pectinesterase inhibitor 7 OS=Arabidopsis thaliana OX=3702 GN=PME7 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000314	0.999674	CS pos: 23-24. Pr: 0.9742

TMHMM  Annotations     

There is no transmembrane helices in CVL06057.1.