CAZyme Information: CVL02473.1

Basic Information

• Species: Fusarium mangiferae
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium mangiferae
• CAZyme ID: CVL02473.1
• CAZy Family: GH43|CBM6
• CAZyme Description: Related to UDP-glucosyl transferase family protein [Source:UniProtKB/TrEMBL;Acc:A0A1L7U2E9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
546	FCQH01000013|CGC3	62050.04	9.8061

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FmangiferaeMRC7560	16149	N/A	345	15804

• Gene Location: location=FCQH01000013:26501-28196(-)

Full Sequence      

MSLPKAQILVVVTVGGSTNSAPILEICSILAARGHTIDFATLSGRQKLVDNYPFVKKVHI
VGPAISAEEDEKHYILFSRWNWNTARGKRDIVKGKMAFDAFWPFTYRGLKEVITTTKPDF
IFSDFHVEAALDVCNEFRLPHAVMWPQMPWLMMPQKYIPGQPGMQQRCLTSEHASIYDRL
FEMTFLLRSAPFFLHWIFWTKAMRRKEGVAPRPRHSKPDYLVFMNNFYGMETPRDTPPLV
HPVGPILADSYPALDGDIKSFVETHQKIALVAFGTHVILDDGKIFKIIDGLADAISSGVI
DGVVWALSARSRGQLDTSIRVPSLHLSHLTIDQLFKNQDQAWHFATWVPQRSVLEHDSTI
IFVTHAGPSSVNESIFHGVPMVAMGIFGDQMVTTLRLERSGVAVRLDKETFDAASLTTAI
RTILLFDKESFQRNVKRMKRIAMVGSRKKHFAANVIEEHLYDWDGRFENSILDLKACSNR
KRGFLQASNSKDMYPRGKELRPMHLQTPDVRMSWIKLNNIDVALLFFILLGIISWITRAA
ANMVRL

Enzyme Prediction     

No EC number prediction in CVL02473.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	172	441	1.6e-28	0.6047120418848168

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.93e-46	10	459	4	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	1.82e-20	22	458	17	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
278624	UDPGT	3.29e-19	347	441	329	421	UDP-glucoronosyl and UDP-glucosyl transferase.
273616	MGT	1.41e-16	346	460	281	390	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
223071	egt	1.78e-15	346	441	352	445	ecdysteroid UDP-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA15179.1|GT1	1.10e-145	4	538	10	529
QKD56593.1|GT1	4.93e-138	4	533	6	510
QKX59607.1|GT1	4.72e-136	4	522	8	504
QLI65751.1|GT1	1.79e-131	8	522	8	497
BCR88254.1|GT1	4.70e-130	4	522	7	504

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2O6L_A	1.57e-13	347	441	75	167	Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens],2O6L_B Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens]
6IPB_A	1.12e-12	347	441	97	189	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]
7CJX_A	5.75e-12	347	424	76	153	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
3WC4_A	2.57e-08	345	441	323	421	Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase from Clitoria ternatea [Clitoria ternatea],4REL_A Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase in complex with kaempferol [Clitoria ternatea],4REM_A Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase in complex with delphinidin [Clitoria ternatea],4REN_A Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase in complex with petunidin [Clitoria ternatea],4WHM_A Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase in complex with UDP [Clitoria ternatea]
7ERX_A	1.09e-07	347	441	339	439	Chain A, Glycosyltransferase [Oryza sativa Japonica Group],7ERY_A Chain A, Glycosyltransferase [Oryza sativa Japonica Group],7ES0_A Chain A, Glycosyltransferase [Oryza sativa Japonica Group],7ES1_A Chain A, Glycosyltransferase [Oryza sativa Japonica Group]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5RFJ3|UD2A3_PONAB	1.37e-15	182	441	202	446	UDP-glucuronosyltransferase 2A3 OS=Pongo abelii OX=9601 GN=UGT2A3 PE=2 SV=1
sp|Q6UWM9|UD2A3_HUMAN	7.46e-15	198	441	233	446	UDP-glucuronosyltransferase 2A3 OS=Homo sapiens OX=9606 GN=UGT2A3 PE=2 SV=2
sp|P36512|UDB13_RABIT	1.00e-14	224	441	260	450	UDP-glucuronosyltransferase 2B13 OS=Oryctolagus cuniculus OX=9986 GN=UGT2B13 PE=2 SV=1
sp|Q80X89|UD2A1_MOUSE	3.07e-14	198	441	234	447	UDP-glucuronosyltransferase 2A1 OS=Mus musculus OX=10090 GN=Ugt2a1 PE=2 SV=1
sp|O97951|UDB18_MACFA	5.42e-14	171	441	202	448	UDP-glucuronosyltransferase 2B18 OS=Macaca fascicularis OX=9541 GN=UGT2B18 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000000

TMHMM  Annotations     

Start	End
520	542